SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007798 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007798
Domain Number 1 Region: 319-612
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.02e-47
Family Glycerophosphoryl diester phosphodiesterase 0.0024
Further Details:      
 
Domain Number 2 Region: 6-109
Classification Level Classification E-value
Superfamily Starch-binding domain-like 2.7e-21
Family Starch-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007798   Gene: ENSMGAG00000007629   Transcript: ENSMGAT00000008580
Sequence length 673
Comment pep:known_by_projection chromosome:UMD2:2:16593131:16626194:-1 gene:ENSMGAG00000007629 transcript:ENSMGAT00000008580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSQVTFEVRGPSVPGEVFAICGSCSALGSWNPQAAVVLQTDDCELWKATIELPRGVPV
KYRYFKGYFLEPKTIDGPCEVIVHTWETHLQPRSITPLENEMTIDDGYFGIHNGIETVDA
GWLTCQAEIRLRLHYSEKSPVMISKKKFKTSRFRVKLTLEGLEKDDDDEEGQEKTSPTVP
QKMANTVEFSLISNNEYKCRHSQPDCGYALQSDRWLEYTIQTMEPDNLELIFDFFEEDLS
EKVVQDDEHPGHVGSACLLSSTIAESGKSAGILTLAIMGRNPRKTIGKVRVDYIIIKPIQ
GYTCDMKASYAKYWKPRTTLDVGHRGAGNSTTTAKLAKVQENTIASLRNAASHGAAYVEF
DVHLSKDHVPIVYHDLTCCMAMKKKLDTEPLELFEIAVKELTFDQLQLLKLAHVTALKVK
DHNASFKEEENSAYETQPFPSLQRVLESVSEDVGFNIEIKWICQQKDGQWDGNLSTYFDM
NLFLDIILKTVLMNAGRRRIVFSSFNADICTMVRHKQNKYPVLFLTQGESKLYPELMDLR
SRTTPIAITFAQFENLLGVNVHSEDLLRNPSYIKRAISKGLVIFSWGDDANDPDNRKKLR
EYGVHGLIYDRIYDSNPEQPNIFQVEQLERLKKELPELKSCVCPTVSHFKSISPCKCHHS
CLEEKVVDNLQSV
Download sequence
Identical sequences G1N6Q8
ENSMGAP00000007798 ENSMGAP00000007798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]