SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007813 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007813
Domain Number 1 Region: 27-209
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.74e-78
Family T-box 0.000000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007813   Gene: ENSMGAG00000007663   Transcript: ENSMGAT00000008596
Sequence length 452
Comment pep:known_by_projection chromosome:UMD2:17:8618473:8635788:1 gene:ENSMGAG00000007663 transcript:ENSMGAT00000008596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVLPDIKAPCEALASPSLEPYPQSSITVTLEDMGLWMKFHQIGTEMIITKSGRRMFPQC
KIKVSGLIPYAKYLMLVDFVPVDNFRYKWNKDQWEVAGKAEPQLPCRTYVHPDSPAPGSH
WMKEPVSFQKLKLTNNTLDQHGHIILHSMHRYKPRFHIVQADDLFSVRWSIFQVFSFPET
VFTSVTAYQNEQITKLKIDNNPFAKGFREHGKNTRREGRAKSQKPSPAKGQKRKLPEEKE
SGAEERDFEKDENVDVKEESNPIVVSSGYPFWISEQNSSHAFPAASPVPAEQREGPAREQ
QVPTPSYQTYRFHEAGDSQQLPSRDVTALNDFRARCHPLDLTSVPEHDSKQLPEGFTNLP
PLPPPLPPPQDYTGVVNWLLDSVGKPGARAPMYSPYGTEQGLGQWMVPPHSQYRAMSYSA
FSTDYNTQGASGHAHGTMAEWSQYPLFPYACW
Download sequence
Identical sequences G1N6R8
ENSMGAP00000007813 ENSMGAP00000007813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]