SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007940 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007940
Domain Number 1 Region: 162-191,386-622
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.82e-49
Family FolH catalytic domain-like 0.00000123
Further Details:      
 
Domain Number 2 Region: 217-404
Classification Level Classification E-value
Superfamily PA domain 7.46e-49
Family PA domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 626-711
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 2.88e-18
Family Transferrin receptor-like dimerisation domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007940   Gene: ENSMGAG00000007710   Transcript: ENSMGAT00000008729
Sequence length 712
Comment pep:known_by_projection chromosome:UMD2:11:14884052:14893879:1 gene:ENSMGAG00000007710 transcript:ENSMGAT00000008729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHARAALSSLFSAEPMSYTRFSIARQTDGDNSHVEMKLSADDEEGVDIERPEHVHDSMA
QPQRNGKKLCFLVIAAVLLLLIGFLIGYLSYRGRMQLAARCQDGSGRCEITPTASYLVDG
DETVEEEIQGPPVIYWPQLKAMLSDKLLAKNLGDRLRQRAGLDSFEAGEAEDTNMATYIH
EQFNSFFLDKVWNDEHYIKLQIRGSTKNKVSVLINDSEEILEMPDAYVAYSESGSFSGKP
VYVNYGLKKDIETIQKSVTPLNGTIVIVRAGKITLAEKVANAKEAGAVGVLMYMDSFKYG
ITGTLTPFGHAHLGTGDPYTPGFPSFNHTQFPPVESSGLPHIAVQTISSSAAAKLFSKMD
GDSCSEDWKGGIHSCKVTTKQESKIMVKLDVNNSMKDRKILNIFGAIQGSEEPDRYVVIG
AQRDSWGPGVAKAGTGTAILLELARVISDIVKNEGYKPRRSIIFASWSAGDYGAVGATEW
LEGYSAMLHAKAFAYINLDAAVLGANHVKISASPLLYMLLERIMKGVKDPAQGSRTLLDR
VGSDWVKAVVPLGLDNAAFPFLAYSGIPVVSFGFYNKDEEYHFLNTKDDTLENLRKIDNL
DALLRAAAEVAGQVALRLTHDHELFLDFGRYGEELLAYQEKFLPYVKDVQELGLTLDWLF
ARGDFQRAADALRRDIANSDRENKVIRRALNDRIMKVEYDFLSPYLSPKEVP
Download sequence
Identical sequences G1N704
ENSMGAP00000007940 ENSMGAP00000007940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]