SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007998 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007998
Domain Number 1 Region: 117-394
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-77
Family Protein kinases, catalytic subunit 0.000000000622
Further Details:      
 
Domain Number 2 Region: 383-440
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000401
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 3 Region: 965-1007
Classification Level Classification E-value
Superfamily UBA-like 0.00000182
Family TS-N domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007998   Gene: ENSMGAG00000007803   Transcript: ENSMGAT00000008787
Sequence length 1049
Comment pep:known_by_projection chromosome:UMD2:11:14908414:14919096:1 gene:ENSMGAG00000007803 transcript:ENSMGAT00000008787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAEEGTDWLLELLTELQLQQYFLRIRDELNVTRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRPDSELPPQPHSTFRKPPTPPPPTQGAHSLTCLIRER
DLSLFEKLGDGSFGVVRRGEWCTPAGKTLNVAVKCLKTDVLSQPEVLDDFIREVNAMHSL
DHKNLIRLYGVVLSHPMKMVTELAPLGSLLDRLRKNQGHFLISTLCQYAIQVAKGMAYLE
SKRFIHRDLAARNILLASNEQVKIGDFGLMRALPKNDDHYVMQEHRKVPFAWCAPESLKT
RTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDVYNVM
LQCWAHKPEDRPTFVALRDFLVEAQPTDMRALQDFEEPDKLHIQMNDIITVIEGRAENYW
WRGQNKRTLKVGQFPRNTVTSVAGLSAHDISQPLKNSFIHTGHGDTNPQQCWGFPDKIDE
LYLGNPMDPPDVLGVDLSAARPTQLPGRAKRQPPPRPPQPSILLTKPSYDPVSEEDEGLS
AGLRKLCLKKPGPGKGLRLAKPSARVPGTKVGERQPSRSPSEGPTSGEVTLIDFGEEVPP
TTPSPVGELTAPSLAKLAMEAFSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAY
DDVAQDEDDFEVCSINSPLGRRGSRAGLPRARERGETNYGFVDEGERAAGLEDNLFLPPK
DTKQPSLTQTTEIFQELQQECMKRFNVPRGPSACLADDKPQIPPRVPIPPRPLRRNEPGR
WSGELSPASGGEEDRPPQIPPRDPLSQPTSRTPSPMALQVGSPQQRAALCSCLSTSPGKP
MPTTQSFALDPKYATPKVIQAQGKDCSKGPCILPIVKDGQKVSSTHYYLLPERPAYLDKY
EKFFKEAKSPEEAPASRVVTTATVRPMVQQQPDYKANFSSNNSNLGPKCLVKASCSLQKI
VYDGPDGYRPSEKIRLVQDTVHGVTTEECQAALQNHGWNVQRAIQYLKVEQLFCLGLKSR
VECHRVLEMFDWNLAQASSHLLDPYSSSR
Download sequence
Identical sequences G1N747
ENSMGAP00000007998 ENSMGAP00000007998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]