SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008005 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008005
Domain Number 1 Region: 858-972
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000119
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008005   Gene: ENSMGAG00000007853   Transcript: ENSMGAT00000008794
Sequence length 1003
Comment pep:known_by_projection chromosome:UMD2:22:11306005:11314389:1 gene:ENSMGAG00000007853 transcript:ENSMGAT00000008794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDSRSLDAAVQSALRALYPPFEATAPTVLGQVFRLLESSYQGDGLCCLLDFLIPAKRLFE
HVRRAACAPYSNCIFLHEGWPLCLHEKVVVHLAPLNPLLLRAGDFYLQAEPCQEHTARIA
LKHLSPDLDSVQETPIPEAAYALLFTNEWLEEINCNHAGSPLHTCLVATENGITPLPWSK
IASPEFVDKPKAGPSGTTGGPSPEPAAPTEPVASITPTAHGTAGSSVPYSNIAGVVPGCR
DSRKPNQGRYPGLIKVEQAGLRQNPTTLAIPSLQDIISQNLEGEYVELLQLSQQDLGLLA
TSRSAAARPWVGSWPCRGVLSSQEGPCTPCQRRRLSGEPGPHGPRCRHRDSYLAALQNPV
SFGPVLMAAILEEPDSSAPLAEPPEPCGSRASTPCPRRARAGGSGGQAVGQRSPHLPPAP
TRSEAAGSGHKFSFLKGPRLGDSAGSQHEGGWRKVSAIYSPRMGRAKPAGKGGVPRFSAP
SHFVNPSPLSPWTGADVAAAAPAEERSLQSTIRQNGPSVLWQELHAGLLHSGIVCLPGGT
DKLGRALLQVTTSSSAWGAMWCSAAELANLLLCLCSLPRKDAKDSGLTAVVDARKQPPSP
TLYSALRSIQNISPGCIHTVLLLAEKEPSAPREKLPGLQVETLTSLKALGRFVDSSQVTA
ELEGTFPYCHGEWVQFFQLPHPFLTGFHMMSPKHFPLCSCSGSDPPAPRCSPCSCPTACT
ALLTPVLPNRGCSPSPPVLDGHWSCCRAASRSFRALTLPPCRAGIDAAEARYAQLEEELH
LLVSLSNSRLERLSALRKVRELEAELDELRQWLDGEGAARLREMGAEECNPDSCEKSTER
WSEFLLQAAARHRHGLALCQQADKLQDSVSPEAEPLQAAVALLRTKLMSFQQRMERRRAE
LEMLHELRQFSSKITCLNAGCRQCSAQAKHGGVPAGRPEALQRLESSFQRLSVEFSTEKL
QEMRAQLRRMQSSSGTGAWTAAWHKYQETRQSLQPALLRVSIP
Download sequence
Identical sequences G1N754
ENSMGAP00000008005 ENSMGAP00000008005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]