SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008075 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008075
Domain Number 1 Region: 222-539
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.12e-91
Family p120GAP domain-like 0.0000305
Further Details:      
 
Domain Number 2 Region: 96-218
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000456
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 
Domain Number 3 Region: 44-95
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000756
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008075   Gene: ENSMGAG00000007886   Transcript: ENSMGAT00000008864
Sequence length 922
Comment pep:known_by_projection chromosome:UMD2:19:8583484:8609845:1 gene:ENSMGAG00000007886 transcript:ENSMGAT00000008864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSRSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSG
SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVENMLKLWIIEAKDLPAKKKYLCELCLD
DVLYARTTCKLKTDNVFWGEHFEFNNLPSLKNITVHLYKETDKKKKKDKTNFIGQVNIPV
SSVTGRQFVEKWYPVVSPNPGKGKSPGPMIRIKSRYQSMSILPMEMYKEFAEYITNNYMV
LCSVLEPSLSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLA
TKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSSDLPEHQSNLKMCCELA
FCKIINSYCVFPRELKEVFASWRQECSNRGRPDISERLISASLFLRFLCPAIMSPSLFSL
LQEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNP
ETISNTAGFEGYIDLGRELSTLHSLLWEVISQLEQSTATKLGPLPRILRDVNSALSNPAC
VQVSVTADHTASTPSAGNSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSAG
AQPSPARSSSYSEANEPDVQMSNGSKSLSMVDLQDNRLLDSGANAPGAADSLNDSQSSLG
QLQGVWSARTQQSSMSGMATVRRVTRTGPSSRIYKHCTAAPVPLEPWCPWTFHFAPLDPP
VSSNGEARAGRKRCFPIESRVPSVQSLAALRSWSTSVLHRDLAVQGAEIEAEDLSVPKGR
VVTVIQAQRRRAPRSCPAAAVSPPPPEFTWAAVKPMPEGTGCTFPHLQRKDEEAEGLMGS
GSVSGERWTQGLYITEVGSSPLIGPQCSMSSAPSPVNPSALDRTAAWLLNMNMQFLEDES
IDPDSKHRDKLRNKDELSQAEK
Download sequence
Identical sequences G1N7A5
ENSMGAP00000008075 ENSMGAP00000008075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]