SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008077 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008077
Domain Number 1 Region: 151-466
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.37e-127
Family Transglutaminase core 0.000000000621
Further Details:      
 
Domain Number 2 Region: 7-150
Classification Level Classification E-value
Superfamily E set domains 3.5e-43
Family Transglutaminase N-terminal domain 0.0000201
Further Details:      
 
Domain Number 3 Region: 474-589
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.14e-31
Family Transglutaminase, two C-terminal domains 0.0000286
Further Details:      
 
Domain Number 4 Region: 591-690
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.6e-28
Family Transglutaminase, two C-terminal domains 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008077   Gene: ENSMGAG00000007887   Transcript: ENSMGAT00000008866
Sequence length 694
Comment pep:known_by_projection chromosome:UMD2:22:11322503:11330631:1 gene:ENSMGAG00000007887 transcript:ENSMGAT00000008866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPHAVPFTELVLETCDLQCERNGREHRTAEMGSQQLVVRRGQPFTITLNFTGRGYEEGVD
KLAFNVETGPCPIETSGTRSHFTLTDCPEEGTWNAVLQQQDGAVLCVSLCSPCNARVGRY
RLTLEASTEYQGSSFHLGDFVLLFNAWHPEDAVYLQEEDERREYVLSQQGLIYMGSRDYM
TSTPWNFGQFEDEILAICLEMLDINPKFLQDQNLDCSHRNDPVYIGRVVSAMVNCNDEDH
GVLLGRWDNHYEDGMSPMAWIGSVDILKRWRRLGCQPVKYGQCWVFAAVACTVMRCLGVP
CRVVTNYNSAHDTNGNLVIDRYLSEEGVEERRSRDMIWNFHCWVECWMTRPDLAPGYDGW
QALDPTPQEKSEGVYCCGPAPVKAIKEGDLQVQYDIPFVFAEVNADVVYWIVQSDGEQKK
STHSSMVGKNISTKSVGRDSREDITHTYKYPEGSEKEREVFSKAEHEKSSLGEQDEGLHM
RIKLSEGANNGSDFDVFAVISNDTDRERECRLRLCARTASYNGEVGPQCGSKDLLNLTLQ
PRMAQSVPLRILYEQYGPNLTQDNMIKVVALLTEYESGDSVVAIRDVYIQNPEIKIRILG
EPMQERKLVAEITLVNPLAEPLNNCTFVVEGAGLTEGQRIEELEDPVEPQAEAKFRMEFV
PRQAGLRKLMVDFESDKLTGVKGYRNVIIAPLPK
Download sequence
Identical sequences G1N7A6
ENSMGAP00000008077 ENSMGAP00000008077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]