SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008212 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008212
Domain Number 1 Region: 1073-1243
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000536
Further Details:      
 
Domain Number 2 Region: 510-715
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-46
Family DBL homology domain (DH-domain) 0.00052
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 7.19e-32
Family Bcr-Abl oncoprotein oligomerization domain 0.0000318
Further Details:      
 
Domain Number 4 Region: 729-798,856-891
Classification Level Classification E-value
Superfamily PH domain-like 2.3e-16
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 5 Region: 933-1059
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000234
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008212   Gene: ENSMGAG00000008006   Transcript: ENSMGAT00000009002
Sequence length 1294
Comment pep:known_by_projection chromosome:UMD2:17:8965318:9068065:-1 gene:ENSMGAG00000008006 transcript:ENSMGAT00000009002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDPVGFVEAWKAQFADSEPPKMELKSVGDIEQELEMCKASIRRLEMEVNKERFRMIYLQ
TLLAKEKKSYDRQRWGFKRASQLPEGGADQQVQDLPHHQSADQDEHEKKDTESRCDTDGS
PSKHRSSSTRRLVGSAEKEGLFEPISKDRGNSTSVAALRSNFERIKKGNSHHSGDNKDVV
EKPFYVNMEYHHEKGLVKVNDKDVSDKISSLGSQAMQMERKKSLHSLPSNMVPSFNEFQR
SAYRGRSSESSFGYDGEYEDAELNPRFLKDNLINANGSNRSPWQPMDFQPYQSIYVGGMM
GETEGKGPILRNQGTADQEKHLTWPRRSYSPRSFEDIGGGYTPDCSSNENLTSSEEDFSS
GQSSHVSPSPTTYRMYRDKSRSPSQNSQQSFDSSSPPTPQSQKRHRQQQVIVSEATIVGV
RKTGQIWPSDGDLPSGRSHQDSLFHGDADASFSGTPPSYAYDADRAEEQRRHHDMMPYID
DSPSSSPHLSSKSRGSRDTLSSGSLESTKSSEPDLEKGLEMRKWVLSGILASEETYLSHL
EALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRV
GDLFQKLASQLGVYRAFVDNYEVAMETAEKCCQANAQFAEISENLKARSTKESKDQTTKN
SLETLLYKPVDRVTRSTLVLHDLLKHTPVSHPDHPLLQDALRISQNFLSSINEEITPRRQ
SMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLFLCAKLKKQIGGKSQQYDCKWYI
PLTDLSFQMVDESEAVPNIPLVPDEELDAMKIKISQIKNDIQREKRANKGSKVIERLKKK
LSEQESLLLLMSPNMAFRVHNRNGKSYTFLISSDYERAEWRENIREQQKKCFKSFSLTSV
ELQMLTNSCVKLQTVHNIPLTINKEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDS
FGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRILCYEKCYNKMKLTKEDGESTDRI
MGKGQIQLDPQTLQDKDWQRTVISMNGVEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIA
IVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMS
EMDVNAIAGTLKLYFRELPEPLFTDELYPNFAEGIALSDPVAKESCMLNLLLSLPEPNLV
TFLFLLDHLKRVAERESINKMSLHNLATVFGPTLLRPSEKDSKIPANPTQPITMTDSWSL
EVMSQVQVLLYFLQLETIPTPDSKRQSILFSTEV
Download sequence
Identical sequences G1N7L2
ENSMGAP00000008212 ENSMGAP00000008212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]