SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008237 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008237
Domain Number 1 Region: 28-141
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.23e-37
Family Frizzled cysteine-rich domain 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000008237
Domain Number - Region: 175-261
Classification Level Classification E-value
Superfamily TIMP-like 0.000126
Family Netrin-like domain (NTR/C345C module) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008237   Gene: ENSMGAG00000008065   Transcript: ENSMGAT00000009027
Sequence length 285
Comment pep:novel chromosome:UMD2:1:20770256:20773539:-1 gene:ENSMGAG00000008065 transcript:ENSMGAT00000009027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTVKILVFIVSGFLRVGTGFDIGLSTKCVVIPKEMDMCHEIGYSEMRLPNLMGHTSMA
EVVLKSTTWQHLVHTDCHPHVRMFLCSLFAPICLDTFIHPCRSMCVGVRDSCAPVLACHG
HAWPESLDCNRFPADEDMCLASLTKEYKYLHKVLPKPACQTCPAVEELFTHKRVPEVFCD
SNFAVKVKLSKKRAVIGDQEYNIECHVEFITQGSLLPYETQHMIQQWLLINENCTQRMTQ
THRPMVYLLVGKIEEGIILVNQIYRWQRRDSQLTLATQKWRYHKC
Download sequence
Identical sequences G1N7N4
ENSMGAP00000008237 ENSMGAP00000008237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]