SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008273 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008273
Domain Number 1 Region: 2550-2834
Classification Level Classification E-value
Superfamily BEACH domain 5.23e-123
Family BEACH domain 0.0000000345
Further Details:      
 
Domain Number 2 Region: 2952-3111
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.1e-19
Family WD40-repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 2401-2523
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-19
Family PreBEACH PH-like domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008273   Gene: ENSMGAG00000008076   Transcript: ENSMGAT00000009065
Sequence length 3111
Comment pep:known_by_projection chromosome:UMD2:8:20620271:20740389:1 gene:ENSMGAG00000008076 transcript:ENSMGAT00000009065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WQLEDSSCEAGQQEQSPDHVDKSEVPEQPAHRKDNLPQSHTLQWETLCRQFVEYEQAAPF
LIPEEQQRRLLDFLPFFLKAWEQSAGVIVFPSVQLLASEVSKLLTKEIKRTLNGKSAVTE
EARLALEHLLQQKGEVEDGHLLLKSVYLLSRTDLKTMWNIIGSGLPAALLQCLYLFFTFP
LKRNTDGETNEDETQKMLVEIMLNMYREEQGVEELLAADKLQSLIIAAASLWDQCSHPWK
VPTGLVLRTISKAQTKNSILYLQAVDCIKIAVQNLFKLADTLPACDVCEAVSIVLCFVKD
SYPISSALLTEFESNDGYQLLLKVLLRCEGLQQNEGDPYLNEILDMLTCLTTCGKTELKV
SGNIIHPQLPQFDYEWTRSSGMTVKNLQAFQVLQSIFQKSNDQHLCGTVLGAIGTIWAWD
TVNFFLLEWTLQPINQFIDIIHFKPHPVQVQFFRLVESIVLDLSYIPHEILKKVQYLIKE
NVVPFCTLTALQCLLSITKKDLLFSDIFRDSGLLGLLLAVLRKQAKILRKSVNNTLIAGT
SLPGVEEGTDKELNAVMLKMVAALTVGCVRNSVVLKDYGMVPYIKIFLDDECYRGATLSI
LEQLSVINYEEYMSIVIGALCSSTQGELHLKLDLLKSLLRILNSPKSHSAFRTCSGFNGL
LSLLSDMEGALQDPPYGLWAAVGQNCILELVFYTLQGITAALHLDPVNSNFFQRNGLFEK
MAEDLGSLGCFWTHTEWHIPLSLEKTRTFTEFLDAAFCSSEPFPAWLKNCIWILSFLDHM
IKGTLHLENYFKEINSEMGEASREDQEGTQAHGEHPVFSERPVFSCRWEMRDCVIVNPGA
VCVMVRLLPKLYREGHSQISQEIQCAVADHIQSLVKSEKSRQVMCGSGLLSTIITSCQDA
FRNESHPLHLPLTRVFEKLASQSIEPDVLRQFLCLGSSLSVPSPPNTKRTEVLSCQESDS
SKASLNEEEVVADSKTALQTAVPLSNSSWASKRSALALQTAMSLISMTSPRNLQLHSSTA
LAPSFVEFDMSMEGYGCLYLPTLATVLGPSAEQSVSGGIGMCSRMFPPSSGLTLSCWFLV
SKFGMVHNSHPLRFLTIVRHMSRTEQEFVCFSVSFSPQDCSLVISTEEVEFQPLDIMEPE
GEVQNISPFPEEVQFGCGKLLVTGQWHHLTVTVAKEAKKNCVVSAFINGQMLGSAKMRYF
QMLPGNCISMDPSSFIDVYGYIATPRVWKQKSSLIWRLGPTYLFEEAISVETIEVINKLG
PQYCSNFQAVQLQGENQYGEQNPAQLVAEEKISFGINAVCSSFCTIQDIRSSYNEVDGRL
VAKEIGINSRDGSTPILLAKNIAGHLSGSLRTIGSVAVGQYGVRVFKSSPAATSLNFIGG
PSILLGLIAMASDDHTMYAAVKVLNSILNSSPMSEKLMRHIGGYQLLTYLLKRKTQLLNN
RILQLMFSLVGTAELGFGSSVIKNYNAFQYILCNFELWMKAPENLDLTLFAHLVEILQCS
RDGCQNAEVAHRVQMVPKLIFLFSDPEISNSRITVVCTILSHLLQGYFNTKDVLRIGLFL
VYTLKPSSVDENQLCLDSSAEMPSEALSQTSGKTIWLRNQLLKMLLDVICSAKIHLSSEV
QEEAFLALGPDWFLLFTQSYLHSSTVVLGIKLLLYFLHNRLLLNKFKEGIVAGRWLENST
AGLSILMDNLKTHPLVPDSGSILIFGFSVLQKCLTDHVHIPEIYLLVAGLFLATPYSEPP
EAAKGDLDSMLQWILQQHVTENVLKNGLCAEAAVLLLEMVRVIVDKPIAGAEVSWEIVYP
GNVIQFLCLIYHSYTEDPVWHCPDFLKTLAVVAFHSGPPKGGKTSEGLLTPDGPAIAEGK
GCTDSSLPRLSHPAKKQVWDFMHILLMDSLLNTPANKQEHPLELLLEASPEDATSEQKKH
FQTKVLLSAMDVFDVTSQGEGKTRPRGNSDLHSSSESTASASMMNVTYVAQKLIEKMNSK
MFAADFKQILLFIAKQITRVLEAPVSQKDVFLSTMYSCLNRAILYCLSRPQQSLPEQFNV
LNALSVLQEQWDIIFATYNSSNNFIICLMHCLCQLNSGSYPEGFGVDAKPKLASYHQIFL
APSEEERKKRDTPNWSDLQVHQEILRTIEIIWKQLISQRRQALEDIYNMDLSVKGSDRER
DIKITEITPLWEEMMAKAWQNFLGLTASEKRVLQNKSVLGLSQSKHSSWSESLSSAMRLM
PSRNTKEMTCKSEGFVSCMERYRRTGQELYASLYRNHVQVLQCGYSKAAKDWMILEEQLF
NRQGPWGVASQSLNPRWILDCYEGPSRMRRRIRQASNQATMMRMKSEVLLENRNETTSTA
EVDSDIGELMLNGAEKEGDEKGLDCNQLTFFPALHESFHSEDFLELCVERQIILQEFAEN
EKVTFKCSVAVVQGHTALEGVLLFGREHFYICECFVLSPLEEVCCTQHCLSSISDPFIFN
LCHKEHVVGDQRCSRYSYHDIKEIRLMRFLLQEIALEIFFKNGYSRFLVFHDCDRKKIFK
RFCFFQPALKSKGVTEESLNIRKHSGGEKIMLQKWQKREISNFDYLMYLNTLAGRSYNDY
MQYPVFPWVLADYHSQTLNLSNPHTFRDLSKPMGAQTVERRQKFIQRYKEVEKSEGDLSA
QCHYCTHYSSAIIVASYLVRLEPFTQTFCSLQGGSFDVADRMFHSVKSTWESASRDNMSD
VRELIPEFFYLPEFLTNANHFELGCMQDGTVLGDVQLPPWADGDPHKFILLHRQALESDY
VSAHLHRWIDLIFGHKQQGSAAVEAVNTYHPYFYGDKMNLNNIKDPLIKSTILGFISNFG
QIPKQLFTKPHPPRNVQSKSSSGREAVLSFQSNGILPPFISSLQNLKLSPVTVKELNTFF
VLSEYPKGAVGHIVHTEKGILAVEKNKVLIPPLWNKTFCWGFDDFTCCFGNYGSEKNMTT
SECMADWGKCLCAVCPSATTIITSGTSSVVCVWELSLVKDKVKRLSLRQALYGHSQSVTC
LAASVTYSIIVSGSDDRTCIIWDLNHLTYITQLPAHGASLSSVAINNSTGDIASCAGSYL
HLWTVNGQPLVSVNTTCSPKSCIACCCFAEVMDWDTRSIVITGSTDGVVRV
Download sequence
Identical sequences G1N7R4
ENSMGAP00000008273 ENSMGAP00000008273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]