SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008284 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008284
Domain Number 1 Region: 197-582
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.57e-158
Family Myotubularin-like phosphatases 0.0000000000118
Further Details:      
 
Domain Number 2 Region: 74-195
Classification Level Classification E-value
Superfamily PH domain-like 5.78e-40
Family GRAM domain 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008284   Gene: ENSMGAG00000008089   Transcript: ENSMGAT00000009077
Sequence length 641
Comment pep:known_by_projection chromosome:UMD2:9:17695332:17724059:-1 gene:ENSMGAG00000008089 transcript:ENSMGAT00000009077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPTGSHVEWCKQLIAATISSQISGSVPSEGVPRDYRIRVGGQESPCCFECQVNVASHLCE
ALRDGNKLAQMEEAPLFPGESIKVIAKDVMYICPFMGAVSGTLTVTDFRMYIKSVERDPP
FVVDVPLGVISRVEKIGVQSHGDNSCGIEIVCKDMRNLRLAYKQEEQNRLEIFENLVTRA
FPVSNGLPLFAFSYKEKFAVNGWKVYDPMSEYKRQGLPNESWKISKINSTYELCDTYPSV
LVVPTSVKDDDLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKHCKEDEKYL
QTIMDANAQSHKLIIFDARQNSVADTNKAKGGGYESESAYPNAELVFLEIHNIHVMRESL
RKLKEIVYPTIDETRWLSNVDSTHWLEYIRMLLAGAVRIADKIESGKTSVVVHCSDGWDR
TAQLTALAMLMLDSYYRTIKGFEILIEKEWISFGHRFAMRVGHGGDDHADADRSPIFLQF
IDCVWQMTKQFPAAFEFNELFLITILDHLYSCLFGTFLCNCEKERLKEELSTKTVSLWSY
INSQLDEFTNPFYVNYENHVLYPVASLNHLELWVNYYVRWNPRMRPQVPIHQNLKELLAI
RTELQKKVEDLQREAATRSLSSSSDRGSSPSHSATPVHTSV
Download sequence
Identical sequences G1N7S2
ENSMGAP00000008284 ENSMGAP00000008284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]