SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008286 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008286
Domain Number 1 Region: 1370-1433,1467-1646
Classification Level Classification E-value
Superfamily VPS9 domain 2.62e-41
Family VPS9 domain 0.0024
Further Details:      
 
Domain Number 2 Region: 20-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-38
Family Regulator of chromosome condensation RCC1 0.0055
Further Details:      
 
Domain Number 3 Region: 519-679
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.96e-27
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 4 Region: 1039-1128
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.66e-21
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 5 Region: 1133-1241
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.14e-19
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 
Domain Number 6 Region: 919-1005
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000341
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 7 Region: 684-885
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000301
Family DBL homology domain (DH-domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008286   Gene: ENSMGAG00000008034   Transcript: ENSMGAT00000009079
Sequence length 1649
Comment pep:known_by_projection chromosome:UMD2:7:11707545:11738611:-1 gene:ENSMGAG00000008034 transcript:ENSMGAT00000009079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSNKYKISEEAEGAKERGLVYTWRAGSCSITPERLPGLCGKTVLQAALGTNHGLLLTDGG
EVYSFGKLPWRSGPEEFCANSPILENTLLGQHVITVAAGSFHNGAVTEGGVVYMWGNNSS
GQCAVANQPFVPEPQPISISDSETSPLLSVRILQLACGEEHTLALSLSREIWAWGSGCQL
GLITTTFPVIKPQKVEHLAGRVVLQIACGAYHSLALVQCLPVQEMKPIPERCNHCSQLLI
TMTDKEDHVIISDSHCCPLGVALADKQPENHAFCSSLENLEGKSVTGSESEDCKKPLVEE
HALVALESDGASLLSSNNGQEESGISSLGNILCTDKKEVKEYLISLSDHTLNESLEKNTC
TGSEQPLMREQTGACIPGPPGTSASALNSLVASCASAVGVRVAATYEAGALSLKKVMNFY
GTPSNEPSPQPGSGSTGPEALKDSREEQVKLESMQGKKSSSLVDIREEESEGGSRRLSLP
GLLSQVSPRLLRKVGRAKMRTVALTPTYSGEADALLPSLRTEVWSWGRGKDGQLGHGDVL
PRLQPLCVKSLDGKEVIHISAGGHHSLALTAKSQVYSWGSNIFGQLGHTNSPTTVPRLAK
VCGDGVWSTAAGSDYSLFLADEEDFQPGLYYCGQETTTDNLTESNCSKSPVLLLSCSKIG
YISNVIAGGDNCLVLVDKNIMGYIASLHELASTERRFYFRLSEIKSQVLRPLLGLDNLGS
ANTIQLLQEMASRFSKLCYLIGQHGASLSSFLHGVKEARSLAILKHSSLFLDSYTEYCTS
ITNFLVMGGFMLLAKPAIDFLSKSQELLQKLSEYNEENLQLVDVLNALFFMPFGRLHDYA
RTLLKLATCFEVASPEYQKLQDSSSCYESLAVHLGRKRKEAEYTLSFWKTFPGKMTDSLR
KPDRRLICESSNRGLSLQHAGRFSVNWFILFNDALVHAQFSTHHIFALSTLWVEALSEEA
GNVNGLKITTPEEQFVLLSSTPQEKTKWLRAISQAVDQALKGTSDIILYGAGGNVPRQEP
PISRSAKYVFYKDPRFKDAVYDGRWLSGKPHGRGILKWADGRMYSGTFRTGLEDGYGEYR
VPNKILNKDDHYVGYWKEGKMCGHGVYSYATGEVYEGCFQDNMRHGHGLLRSGKLTSSSP
SMFIGQWTMDKKSGYGVFDDITRGEKYMGMWQDDLCQGNGVVVTQFGLYYEGAFSTNKMM
GTGILLSEDDTVYEGEFSDNWTLSGKGTLTLPNGDYIEGLFSGEWGSGIKITGTYFKPSL
YESEKDKPKTLRKLGILAVPPDEKWKAVFEECWNQLGCESPGQGDRWKAWDNIAVALTTN
RRQHKDSPELLSRSHTQTLESLEFIPQHIGAFTLEKYESIKKYLIKACDTPLHPLGKLVE
TLVAVYRMTYVGVGANRRLLQEAVREIKSYLKRIFQLVRFLFPDLPEEGSTIPFQPTEIK
GRRSFCSGKSDSRSESPEPGYVVTSFGLLLPVLLPRLYPPLFMLYALDNEREEDVYWECV
LRLNKQTDMALLSFLGVQVKFWPGTVSILGESRKVSSNTKDACFASAVECLQQISTTFTP
ADKLKVIQQTFEEISQNVLESLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVHLIEDLM
DPYLQHGEQGIMFTTLKACYYQIQHEKLT
Download sequence
Identical sequences G1N7S4
ENSMGAP00000008286 ENSMGAP00000008286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]