SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008312 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008312
Domain Number 1 Region: 48-162
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.01e-42
Family Frizzled cysteine-rich domain 0.00000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008312   Gene: ENSMGAG00000008142   Transcript: ENSMGAT00000009105
Sequence length 454
Comment pep:known_by_projection chromosome:UMD2:7:11842000:11844073:1 gene:ENSMGAG00000008142 transcript:ENSMGAT00000009105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPGPGPALHHPPASSVPPLTALLAALLGTPCAAAHQDDKAISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAPPGPGGAGGRGA
TVQPTAGYLPDLTPPQPATGFSFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRPNGLMYF
KEAEVRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYAA
GFLLEERVVCLERFSEDGYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAA
GMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGIYSVDSLRGFV
LAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGT
Download sequence
Identical sequences G1N7U9
ENSMGAP00000008312 ENSMGAP00000008312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]