SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008322 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008322
Domain Number 1 Region: 33-239,414-500
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.71e-60
Family Bacterial dinuclear zinc exopeptidases 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008322   Gene: ENSMGAG00000008124   Transcript: ENSMGAT00000009116
Sequence length 516
Comment pep:known_by_projection chromosome:UMD2:3:41282330:41294991:-1 gene:ENSMGAG00000008124 transcript:ENSMGAT00000009116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDFKLFEVNSAHLSLVLLSTARMSLSSFSVLETEIFRYIDAHQSDFIENLKEWVAVESDS
VQPELRKEVIRMMSLAAARLAALGATVNSVSLGSQQLLNGQHLPLPPVVLGELGKDPQNL
TICFYGHVDVQPAKKEDGWKTDPYTLTEINGNLYGRGATDNKGPVLAWINAVETFRAFKI
AMPVNFKFVIEGMEEAGSLGLEKLLEEEKQGFLSDVDYIVISDNLWLSKKKPALIYGTRG
NACFSVEVEGGDKDLHSGTFGGIIHEPLTDLIALLDSLVDPTGHIQIPGIYDAVAALTDE
DKKLYESIEYDIEEHKNNSGVKKLLFSTKKEEILLHLWHYPSLSIHGIEGAFHEPGIKTV
IPAKVIGKFSIRQVPNMDLSDVKQQVVDHLENVFAKRNSPNKLKVSMPLGAKPWVADVND
PLYKAAKRAIRTVFGEDPDFIRDGSTIPIARIFQTITQKRVIMFPIGAADDGEHSQNEKI
SRHNYIEGTKVFAAFFLEISKLRGQLHETSNPRTNN
Download sequence
Identical sequences G1N7V9
ENSMGAP00000008322 ENSMGAP00000008322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]