SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008372 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008372
Domain Number 1 Region: 5-211,385-471
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.91e-62
Family Bacterial dinuclear zinc exopeptidases 0.00085
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000008372
Domain Number - Region: 322-367
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00174
Family Bacterial exopeptidase dimerisation domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008372   Gene: ENSMGAG00000008157   Transcript: ENSMGAT00000009168
Sequence length 473
Comment pep:known_by_projection chromosome:UMD2:3:41311734:41324966:-1 gene:ENSMGAG00000008157 transcript:ENSMGAT00000009168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALDTLFKYIDEHQDLYVKRLAEWVAIQSVSAWPEKRAEIRRMMEVAAKDIERLGGTAQ
LMDIGTQKLPDGSEIPLPPIILGKLGSDPHKKTVCVYGHLDVQPAALEDGWDSEPFTLVE
RDGKLYGRGSTDDKGPVLAWLNALEAYQKTNQEFPVNIKFCLEGMEESGSEGLDELIFAQ
RNAFFKDVDYICISDNYWLGKNKPCITYGLRGICYYFIEVECSDKDLHSGVYGGSIHEAM
TDLIALMGSLIDKKGKILIPGINEAVASVTGEELAIYEKIDFDLEEYAKDVGATKLLHDT
KRDILMHRWRYPSLSLHGIEGAFSASGAKTVIPRKVIGKFSIRLVPNMTPEEVTKHVKDY
LSKQFAELQSPNKFKVYLGHGGKPWVSDFDHPHYMAGRRAMKTVFGVEPDLTREGGSIPV
TLTFQEATGKNVMLLPVGAADDGAHSQNEKLNRYNYIQGVKMLGAYLYEVSQL
Download sequence
Identical sequences G1N7Z4
ENSMGAP00000008372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]