SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008487 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008487
Domain Number 1 Region: 221-545
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.45e-54
Family Diacylglycerol kinase-like 0.0076
Further Details:      
 
Domain Number 2 Region: 109-182
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008487   Gene: ENSMGAG00000008277   Transcript: ENSMGAT00000009285
Sequence length 569
Comment pep:known_by_projection chromosome:UMD2:20:8803846:8812419:-1 gene:ENSMGAG00000008277 transcript:ENSMGAT00000009285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCVLRTATGEPSQHRTASSRTGVLVFWTLCSVILPVLITLWCSFHRSRRQMLIRDIFYKS
EHDWHYTDLFGQPSYCCVCAQHVLRGTFCSCCGLRVCEGCLKKADQHFLCKEIVMRSEGG
ARGSMPHHWIRGNVPLCSHCMVCKQQCGTQPKLCDYRCVWCQCTVHDECMLDCLKVEECT
FGEFRDLIIPPYYLSTIDQMRKDKRTDYEKVVPYCREHWIPVIVLANTRSGNNMGETLLG
EFKILLNPVQVFDLSKITPAKALQLCSLLPCNAVRVLVCGGDGTVGWVLDAIDEMKIKGQ
ERFIPQVAILPLGTGNDLSNTLGWGAGYAGEVPVEQILRNVMEADGIVLDRWKVQVTSKG
YYNLRKPKVFTMNNYFSIGPDALMALNFHAHREKTPSLFSSRIINKAVYFFYGTKDCLVQ
ECKDLNKKVELELDGERIELPNLEGIIVLNIGYWGGGCRLWEGMGDEPYPLARHDDGLLE
VVGVHGSFHCAQIQVKLANPVRLGQAHTVRLILKSSKMPMQVDGEPWAQGPCTVTITHKT
HALMLYHSGEQTDDDASSVSEQEHMREQT
Download sequence
Identical sequences G1N881
ENSMGAP00000008487 ENSMGAP00000008487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]