SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008523 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008523
Domain Number 1 Region: 514-578,799-1134
Classification Level Classification E-value
Superfamily Ras GEF 7.59e-82
Family Ras GEF 0.00021
Further Details:      
 
Domain Number 2 Region: 198-293
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000000119
Family DBL homology domain (DH-domain) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008523   Gene: ENSMGAG00000008333   Transcript: ENSMGAT00000009322
Sequence length 1137
Comment pep:known_by_projection chromosome:UMD2:Z:67678332:67773926:-1 gene:ENSMGAG00000008333 transcript:ENSMGAT00000009322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYFTVLFGHEGQKPLELRCEDEGDGDEWVEAIHQASYSDILIEREVLMQKYIHLVQIVET
EKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQGNQEDEDPDIKNSLEKVVSY
LRVWKCLKMWSFICHPNVHRAQSLRLHNFFSAALSELDLIPLGHLVLSASLHSVAAVLDS
LKFPVTFPVSFSLKLSDETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEF
VRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQVFHYYTETAYRH
LFSNYIDSNLLRILYILTWSLENEKYTAEVSSSYTEKQFILRQTLNRSLYNADCIEDAAG
QKRKINKLQTNRKKIARNSRVVLFLFFKHVHVVCEPGVHEALLLTTHALLSRIECTIHFL
IAPHNNHSFNGSSRNVGMLECKTQVKPVIEANFEMFINSMILQSENAYILEVSQCIDNIR
CNGLMTIVFEENSKVTVPHMIKSDARLHRDDIDICFSKTLNSCKVPQIRYASVERLLERL
TDLRFLSIDFLNTFLHTYRIFTTAAVVLEKLSDIYRRPFTSIPVRALELFFATGQNNRGE
YLADAKSPHLCRKFSSPPPLSLSRTSSPVRTRKLSLTSPLNSRIGALDLSTSSVASSPTS
TYSPATSPPPTGSKVPLDLSKGPSSPEQSPGSIEKCLVSLHETNQFSTVVGHFIKQYSDY
STSAMDTTELSPCRSPATPRHLRYRQPGGWQNSGVGNCVQTADNSHCAVSPASAFAIATA
AAGHGSPPXKENYRLWSLAKIGFNNSERVCDKEFIIRRAATNRVLNVLRHWVSKHSQDFE
LNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDTHLKIEDIIQMSECPK
PECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPCIMKTSQHFNDMS
NLVASQIMNYADVSSRANSIEKWVAVADICRCMHNYNGVLEITSALNRSAIYRLKKTWAK
VSKQAKVLMDKLQKTVSSEGRFNLRETLKKVCLPTQHNYVMLRTVHKQERTEKYEQILYG
TYEKLSKVSLLSREKTPENQSVFSAFQVTHYLLDKTLIIDEDTLYELSLKLEPRLPA
Download sequence
Identical sequences G1N8A6
ENSMGAP00000008523 ENSMGAP00000008523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]