SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008558 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008558
Domain Number 1 Region: 165-285
Classification Level Classification E-value
Superfamily DEATH domain 8.48e-30
Family DEATH domain, DD 0.00032
Further Details:      
 
Domain Number 2 Region: 51-94
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000673
Family TNF receptor-like 0.0014
Further Details:      
 
Domain Number 3 Region: 2-49
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000118
Family TNF receptor-like 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000008558
Domain Number - Region: 87-113
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00178
Family TNF receptor-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008558   Gene: ENSMGAG00000008349   Transcript: ENSMGAT00000009357
Sequence length 309
Comment pep:known_by_projection chromosome:UMD2:8:21507599:21515273:1 gene:ENSMGAG00000008349 transcript:ENSMGAT00000009357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNDQCCMKCRRGHVKSTECPNTQAHCVPCKSGEEYMDHTNDLDKCMRCRSCDTALGWKVV
KNCTPTENAECSCAKNHYCKSPQCEYCELCTVCENGLVEKECTSTTDTVCRMQEAGMPPW
GTALIVLFVVALAVAAGLILYRKRKQKNFITQGNTGTGRDSSSETFTLISIDDDLSRHIP
DIVREMTLDEVKTFVRHHQLSEPTIDEIIQDNFNNASEQKIKLFQKWHQRHGIRGAYETL
ISSLRDLKMRAVADKIEEKLKAAVSSHQERRESYNDKTGQSNSCSQEGGKSYHDNAEISK
TYPESLEET
Download sequence
Identical sequences G1N8D3
ENSMGAP00000008558 ENSMGAP00000008558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]