SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008565 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008565
Domain Number 1 Region: 2690-2978
Classification Level Classification E-value
Superfamily BEACH domain 8.5e-127
Family BEACH domain 0.000000014
Further Details:      
 
Domain Number 2 Region: 2536-2658
Classification Level Classification E-value
Superfamily PH domain-like 4e-23
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 3 Region: 3449-3517
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.16e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 3049-3213,3397-3441
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.89e-19
Family WD40-repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 1088-1285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000169
Family Laminin G-like module 0.088
Further Details:      
 
Domain Number 6 Region: 473-514,579-657,709-753,873-905
Classification Level Classification E-value
Superfamily ARM repeat 0.0000163
Family Armadillo repeat 0.078
Further Details:      
 
Domain Number 7 Region: 2346-2405
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000748
Family Retinoblastoma tumor suppressor domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008565   Gene: ENSMGAG00000008274   Transcript: ENSMGAT00000009364
Sequence length 3525
Comment pep:known_by_projection chromosome:UMD2:4:28066263:28176214:1 gene:ENSMGAG00000008274 transcript:ENSMGAT00000009364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPSTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEVVGGAQNELPLA
ERRALLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTL
LDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVNELKPAGVTTGVP
FLLPGFAVPQPAGKGHSVRNIQAFSVLQNAFLKAKTSYLAQIILDAITNIYMADNANYFV
LESQHTLSQFAEKISKLPEVQTKYFEMLEFVVFSLNYIPCKELISVSILLKSSTSYHCSI
IAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQALNDQGDSRNSSFED
QKQLALLVMETLTVLLQGSNTNAGIFREFGGARCVHNIVKYPQCRQHALMIIQQLVLSPS
GEDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRTRTVFRKVGGFVYVTSLLVAM
ERSLCSPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVRL
LGCFSDSRKISPLNVFPSNTQLFQRLLEDDLIALDSVSPTLRHCSKLFIYLYKVATDSFD
SRAEQIPPCLTNETSLPSPWGTPALSRKRHAYHSVSTPPVCPQKNIPDLKLQAGSTSMQS
SDAVVIHPGAMLAMLDLLASVGSTTHPEHALDLQLAVANILQSLVHTERNQQVMCEAGLH
ARLLQRCSAALADEDHSLHPPLQRMFERLASQALQPMVLREFLRLGNPLNCGAWDKKLLK
QYRVHKPSSLSFEPEMRNIMVTSMEGLGSDSVFSLHEDSHYRISRSLLKPAEGSTVPLTR
VKCLVSMTTPHDIRLHGSSVTPAFIEFDTSLEGFGCLFLPSLAPHNAPTNNAVTTGLIDG
AVVSGIGTGERFFPPPSGLSYSTWFCIEHFSTPPTNHPVRLLTVVRRANSSEQHYVCLAI
VLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIAEGQWHHLVLVMS
KGMLKNSTAALYLDGQLVNTVKLHYIHSSPSGSGSANPPVVSTVYAYIGTPPAQRQLSSL
VWRLGPTHFLEEVLPAPGVSTIYELGPNYVGSFQAVYVPCKDSKCEGNNPCPVSLVPEEK
VSFGLYALSVSSFTVAKIRKVYNKLDSKAIAKQLAISSHENATPVKLLHNSAGHLNGPAR
SIGAALIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKSN
PLASKEMERIRGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQDL
LCDFEVWLHAPYELHLSLFEHFIELLTESSEAAKNAKLMREFQLIPRLLLTLRDMSLSQP
TIAAISNVLSFLLQGFPSSYDLLRSRFGQFISSTLPTFAVCEKFVVMEINNEEKLDSGTE
DDFGGLVSANLILLRNRLLDILLKLLYTSKEKTAVNLQACEELVKTLGFDWIMMFMEEHL
HSTTVTAAMRILVVLLSNQSILIKFKEGLSGGGWLDQTDSVLTNKIGTVLGFNVGRSAGG
RSTVREINRDACHFPGFPVLQSLLPKHTNVPALYFLLMALFLQQPVTELPENLQVSAPVA
SGRCKQGSQFDLDSIWTFIFGVPASCGTVTSSVHSVCTEAAFLLLGMLRSMLNSPWQSEE
EGSWLREYPVTLMQFFRYLYHNVPDLVSLWMSPEFLCALAATVFPFNIRPYSEMVTDLDD
EVGSPAEEFKAFAADSGMNRSQSEYCNVGTKTYLTNHPAKKFVFDFMRVLIIDNLCLTPA
SKQTPLVDLLLEASPERSTRTQQKEFQTYVLDSVMDHLLAADVLLGEDASLPITSGGSYQ
VLVNNVFYFTQRVVDKLWQGMFNKESKLLVEFIIQLIAQSKRRSQGLSLDAIYHCLNRTI
LYQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSNVDG
FGLEAEARMTTWHIMIPSDIEPDGVYNQDVSEGRQLLLKAINRVWTELIHSKKQVLEEVF
KVTLPVNDRGQVDITVARPLIEEASLKCWQNHLAHEKKCISRGEALVPSTQSKLSRVSSG
FGLSKLTGSRRNRKESGLNKHNLSTQEISQWMFTHIAVVRDLVDMQYKEYQERQQNALKY
VTEEWSQIEYELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYTQYPYMPE
AEQETNLLSDLSSRLPETADDTVPQKKPARYRRAISYDSKEYYMRLASGNPAIFQDTIEE
NTVGETTQQEPEHGEDTIARVKGLVKPPLKRSRSAPDGGDDENQEQSQDQIVEGSSIDEE
EKTDNTTLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRD
IETLPPKMHEPIIPRGARQGPSQLKRTCSIFAYEDIKEVHKRRYLLQPIAIEVFSGDGRN
YLLAFQKGVRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRW
ERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWVLADYDSEELDLTNPKTFRNLAKPMGA
QTEDRLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHF
DLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGCKQNGTKLGDVI
LPPWAKGDPREFIRVHREALECDFVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEG
QVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGEAAGTSVPPGSTGD
KIFFHHLDNLRPSLTPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNKTFAWGYADLS
CRLGTYESDKAVIVYECLSEWGQILCAICPSPKLVITGGTSTAVCVWEMGISKEKAKALT
LKQALLGHTDTVTCLTASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCIN
ELTEACVIYIKTYYLVLGINCNEKKRIQWFQVRTRTTPSECPVTMTFWVSHSFISDTKQH
FWRMEFLQVPETPAPEPAEVLEMQEDCQEAQIGQEAHEEDSSDSDADDPCIGQDVKLQES
QSQPGSTSHRPRSASNRVAAAWSADSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQAKIHP
HAQVNHLHPSYAEARHYSKLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEITALGISK
DHSRILIGDGRGRVFSWSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCG
QLFCQKCSRFQSEIKRLKISSPVRVCQNCFYNLQHERGLEEGPRN
Download sequence
Identical sequences G1N8D8
ENSMGAP00000008565 ENSMGAP00000008565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]