SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008603 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008603
Domain Number 1 Region: 108-206
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.99e-17
Family STAT DNA-binding domain 0.00022
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily STAT 0.00000000000000167
Family STAT 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008603   Gene: ENSMGAG00000008376   Transcript: ENSMGAT00000009403
Sequence length 207
Comment pep:known_by_projection scaffold:UMD2:GL427600.1:8:1087:-1 gene:ENSMGAG00000008376 transcript:ENSMGAT00000009403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEVVAQIQQLLGRSETLRDFLQQELSAWHERQQRSCLGAPLIPACCSCRTGRFTALGEGL
FQLLQLLRAVGELRQKVTYEQDPLQSELPLLEKRLQEQLTCLLQSAFVVEQQPCMPNTPR
PLVLRTANKFCTRARLLVRLHDRNHRMEANIHIDRDLPKTRGFRKFNILTSSSKTVLVGD
SPREGLVCDFQYLTLKEQKGGGSGKGS
Download sequence
Identical sequences H9H1F2
ENSMGAP00000008603 ENSMGAP00000008603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]