SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008609 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008609
Domain Number 1 Region: 49-109
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000169
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008609   Gene: ENSMGAG00000008402   Transcript: ENSMGAT00000009409
Sequence length 226
Comment pep:known_by_projection chromosome:UMD2:13:18974435:18976137:1 gene:ENSMGAG00000008402 transcript:ENSMGAT00000009409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQQLRRAIEECRRAILALPEHSERQKDAVVRLIHLRLKLQELQDPDEEEPNIRVVLEHRF
YKEKSKSVKQMCDKCSTIIWGLIQTWYTCTGCYYRCHSKCLPLVTKPCVRSKVSHQAEYQ
LSICPESGLDSQDYRCAECRAPIALRGVPSEARQCDYTGLYYCSSCHWNDLAVVPARAIH
NWDFEPRKVSRCSMRYLALMVSRPVLKLREINPLLFNYVEELVEIR
Download sequence
Identical sequences G1N8H2
ENSMGAP00000008609 ENSMGAP00000008609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]