SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008635 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008635
Domain Number 1 Region: 118-421
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.29e-107
Family Pancreatic carboxypeptidases 0.00000442
Further Details:      
 
Domain Number 2 Region: 22-111
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.76e-22
Family Pancreatic carboxypeptidase, activation domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008635   Gene: ENSMGAG00000008430   Transcript: ENSMGAT00000009435
Sequence length 453
Comment pep:known_by_projection chromosome:UMD2:7:12512952:12526129:-1 gene:ENSMGAG00000008430 transcript:ENSMGAT00000009435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLRMAVCLGILIPGKFSLKLQYDGDQVLHIVPETLQQVQHLQQLCSTLLLDLWKPLL
PEDIWAGEDLHIRVPAPLVQEVKDSLDQHMISYKILIHDVQELVDQSAPEDTSSHKQIPE
NYDYTQYHPMEEIYTWMAQIQESNSELVTQHYLGETVENRTIYYLQISQPSDRTKKIIWM
DCGIHAREWISPAFCQWFVKEILQNYESDPKIKKFLQNLDLYILPVLNIDGYIYSWETAR
LWRKNRSPHMNGTCYGTDLNRNFNSSWGTLGVSYNCSSEIFCGTGPESEPETRAVVQLIE
RKKSDILCYLTIHSYGQYILTPYGSTTEPPNNNEELMHVAQTAAAALTEKYGTSYEVGST
SLILYNNSGSSRDWAHMIGIPFSYTFELRDKGTYGFILPADQIQPTCEETMLAVTTIIDY
VDQKYFPGGAMMLTSSRLGLSLSLTAVLTLIVP
Download sequence
Identical sequences G1N8J1
XP_010711788.1.16129 ENSMGAP00000008635 ENSMGAP00000008635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]