SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008711 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008711
Domain Number 1 Region: 479-773
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-55
Family Protein kinases, catalytic subunit 0.0000149
Further Details:      
 
Domain Number 2 Region: 255-306
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000159
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008711   Gene: ENSMGAG00000008476   Transcript: ENSMGAT00000009513
Sequence length 801
Comment pep:known_by_projection chromosome:UMD2:21:9566282:9599274:1 gene:ENSMGAG00000008476 transcript:ENSMGAT00000009513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKLIDYIHRQRQCKLSVPLNDRTAELNSYPRFNDWLDIVNVRKEVVQRIPEELTLDALL
EMNESKVKETMKRCGARDEECSRLNGALSCLRKVTGSGIARRENSSTNTTECPCSSAPTW
THSAMNLPKGNGPQARSVSVSTISSSDSLASSHGPSIYADNLLDPFAFPAHGGKLTPRTP
HSITITPPTTPQAKRRHKLKPPRTPPPPCRKVFQLLPNFPTLTRSKSHESQLGNRIDDVP
PIKFELSQGSPQMVRRDFGLAVTHRFSTKSWLSQICQVCQKSMFGVKCKYCRLKCHNKCT
KEAPACRISFFPITKIRRTESVPSDINNPVDRPTEPQFGTLPKAVTKKEHPPAINHLDSS
SNPSSTTSSTPSSPAPFQSSNPPSATPPPNLSPMGQRDGRFNFPEIPSPAQIAQPPETTA
DTNAKEPPDMEGVKHEAEVEEPESNKSEPEDDEDEVEDLPNRRPHLQGMIYRKPSQTSVY
LQEWDIPFEQIELGDPIGQGRWGKVHKGKWHGEVAIRLLEIDGNNQDHLKLFKKEVMNYR
QTRHENVVLFMGACMNPPHLAIITSFCKGRTLYSFVRDPKISLDINKTRQIAQEIIKGMG
YLHAKGIVHKDLKSKNVFYDNGKVVITDFGLFGISGVVQEGRRENELKLPHDWLCYLAPE
IVREMAPGKDEDKLPFSKAADIYAFGTVWYELQAREWPFKNQPAEALIWQIGSGEGVKQI
LATISLGKEINEILSACWSFDLSERPSFTVLMDMLEKLPKLNRRLSHPGHFWKSADINSS
KVVLRFERFGLGILEPSNQKI
Download sequence
Identical sequences G1N8P4
ENSMGAP00000008711 ENSMGAP00000008711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]