SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008717 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008717
Domain Number 1 Region: 151-468
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.43e-97
Family Transglutaminase core 0.000000264
Further Details:      
 
Domain Number 2 Region: 8-150
Classification Level Classification E-value
Superfamily E set domains 3.5e-40
Family Transglutaminase N-terminal domain 0.00062
Further Details:      
 
Domain Number 3 Region: 496-608
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.15e-28
Family Transglutaminase, two C-terminal domains 0.00027
Further Details:      
 
Domain Number 4 Region: 610-709
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.85e-24
Family Transglutaminase, two C-terminal domains 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008717   Gene: ENSMGAG00000008471   Transcript: ENSMGAT00000009520
Sequence length 711
Comment pep:novel chromosome:UMD2:3:20338506:20348002:1 gene:ENSMGAG00000008471 transcript:ENSMGAT00000009520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCFFLHLAVIELGDVDLNCPSNCQIHNTHFFGTDRQIIRRGQAFNFFASFHNREWDDSVD
QATFTVETGLRPCESNETKCTFPMGRCLDQTCWSASYKTHQPKCINISVFPPSNACLGRY
ILNIQITSCGHTYQRCLGDFYVLFNPWCADDPVYLDNQAQREEYILNEHGILYEGVHKHI
TSRPWHFGQFEDGILDICLKILDMGASYHHGSDRDHCWRNDPVHVCMVVNHMISSHTTNS
IMKIPENNDYLKGTKPFSWNGSVPILQQWYNGRCRPVRYGYCGSLASVMCTVMRCLGIPS
RVVTNFCFPCSNENPLGINEIFDCTGKNLCGKDKLWRYHCWNESWMARRDLNQCCGDWQC
LDPTPLETGRGLGSACSGPTWVRSIREGDLDLDYDGHYMFSRLNSNYAGWLSQNNAKKTK
VFCDTWPCGQQLITKSVGSEQFEDITGNYKYESTGSMKSKEAYYRAYRRIHPGYCNASNS
HIDRELSSLKNPFLSDSGINTRLKMANCPMYGEDVQLQWLLENLRSEPKNLKFNLCAQII
TYNGCPMDQFWKDSVTVALGPREVKKIPLCISYSQYGPYLNDHNIMKVVAVSDPECGEVL
MVSRDIVINRPPVIVKLLSHPRLKVPCTAEISFCNPLQEDMKNCIMTLEGCGLFKEPMTI
DLGTLASNQQARTIVEFTPYRLGSHRLLANLGCHKFAYCKGCAKAEVCNHV
Download sequence
Identical sequences G1N8Q0
ENSMGAP00000008717 ENSMGAP00000008717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]