SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008777 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000008777
Domain Number - Region: 1-68
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0748
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008777   Gene: ENSMGAG00000008553   Transcript: ENSMGAT00000009581
Sequence length 93
Comment pep:known_by_projection chromosome:UMD2:21:9714074:9715466:-1 gene:ENSMGAG00000008553 transcript:ENSMGAT00000009581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSEIVEFQKTVGSLIELVDQLAKAAESEKMKAIGARNLLKSIAKQREAQEQQLQALIAE
KKMQLERYRIEYETLCKIEADQNEFIDQFIFQK
Download sequence
Identical sequences G1N8U6
ENSMGAP00000008777 ENSMGAP00000008777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]