SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008803 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008803
Domain Number 1 Region: 43-151
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.05e-36
Family Frizzled cysteine-rich domain 0.0000875
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000008803
Domain Number - Region: 175-302
Classification Level Classification E-value
Superfamily TIMP-like 0.0018
Family Netrin-like domain (NTR/C345C module) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008803   Gene: ENSMGAG00000008569   Transcript: ENSMGAT00000009607
Sequence length 308
Comment pep:novel chromosome:UMD2:14:12236201:12238394:1 gene:ENSMGAG00000008569 transcript:ENSMGAT00000009607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVSTEKASRRRGAPWLPGLLLRLLLWGCPGGRASYLRRSSSCTAIPRSMALCYDIGYS
EMRIPNLLEHETMPEVIQQSSSWLPLLARECHPDARIFLCSLFAPICLDRLIYPCRSLCE
AVKRSCAPVMACYGYPWPEILNCNKFPADHELCIAAVSTDESSSSRRTVPRASCKDCELE
EASTAREILDSLCANDFTVKIRILRKNTTTTVSDFDLDPSRVEVLKHGPLLRTEIPGRLQ
QWLDIDATCAHNIMRGTHAGVFVISGEVQSDKVVVNKAYAWQKKNRNLHQAVRRWKHHRC
PEQAGRKV
Download sequence
Identical sequences G1N8W5
ENSMGAP00000008803 ENSMGAP00000008803 XP_010716916.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]