SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008887 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008887
Domain Number 1 Region: 208-379
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.9e-59
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000217
Further Details:      
 
Domain Number 2 Region: 378-500
Classification Level Classification E-value
Superfamily E set domains 2.69e-31
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008887   Gene: ENSMGAG00000008624   Transcript: ENSMGAT00000009697
Sequence length 1449
Comment pep:known_by_projection chromosome:UMD2:13:19129779:19152149:1 gene:ENSMGAG00000008624 transcript:ENSMGAT00000009697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLT
SNTVQQQQSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSN
MSTSSYNDNTEVPRKSRKRNPKQRPGIKRRDCEESNMDIFDADSAKAPHYVLSQLSTDSK
GNSKAGNGASESQKGAGGKKTPMLCGQYPTKSEGKELKIVVQPETQHRARYLTEGSRGSV
KDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGT
TVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNITRKDGS
TLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDE
NSWKAEAEIDMELFHQNHLIVKVPPYHDQRITSAVSVGIYVVTNAGRSHDVQQFTYTPDT
SAGTLNVNVKKEISSPAQHCSFEEAIKVMKATSCNLEKVNILPSALITPLMPSSMIKNED
VSPMEVSAEKRSPPVFKASKVVGPTQQTLESSIPGIPTSASHLPSENEKQQQIQPKVYNP
ETLTTIQTQDITQSGSFSSVSTPGQLQNSDTLLQQAAQFQTRDSQTREVLQSDGTVVTLS
QLTDASQQQQSTLPEPAQALQQQISSSIFSSASGVSQLQNTIQQLQAGNFPTNTATGSSR
NVDLVQQVLEAQQQLSSVLFSGSDSNEDVQDQLNADIFQQVSQIQNSVNPGIFSSSDTAV
HSRPENLLPGRGENVHSQTENTLSNQQQQQQQQQQQQAMETSAAMVIGIQQNICQAATQM
QSDLFSSTTSGNGALQQSPVYQQASHIMSGLSTSEDMQMQCELFSSSPGVSGSETNSTAQ
QQVSNNGPAIFQASSSADGEEASGQSKQMQSSVFQTMVQMQHSGESQSQVNLFSSTKNMM
TVQPSGAQQQGGGLFQQGGEIMSIQPANFMQQSPHSQAQLFHSQNPIGDTQNISQETQGS
IFHSPNSIVHNQTNANSSDQLQPPMFHSQSTMGVLQSSSVPQDQQSANMFLSQTPISNPA
TQEEQMSFFTNPNSISPLQAAANTEQPTSFQQQTQISHIQSSMLPQEQPQTQPAQQGLFQ
PQVPLGSIQSSSIPQNQQGAIFQPQHSIVAIQSSPPSQEQPQQQQQNMMFSNQNAMSTIA
SQKQNMIFNPNQNPVTNQEQQGQSIFHPQTNMAPINQEQQPMQFQSQTTVSSLQNPGSSQ
AEAQQPAIFHNSPQIQLVQGSPSSQEQQVTLFISSASMSALQNSMSQQDLQQSPMYSSQN
SMAGMQGTASPPQQQASLFHNTAGGAINQLQNSPASSQQTSGIFLFGIQNNCSQLLPSGP
AALPDELMAISQPGQPQSEGQAAVPALLSQQIPETSPLPSAMAPSQNIEKIDDLLVSLQN
QGNNMTGSF
Download sequence
Identical sequences G1N934
ENSMGAP00000008887 ENSMGAP00000008887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]