SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008964 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008964
Domain Number 1 Region: 59-122
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000645
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 278-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000297
Family Ras-binding domain, RBD 0.014
Further Details:      
 
Domain Number 3 Region: 4-53
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008964   Gene: ENSMGAG00000016830   Transcript: ENSMGAT00000009776
Sequence length 506
Comment pep:novel chromosome:UMD2:Z:75048289:75086869:-1 gene:ENSMGAG00000016830 transcript:ENSMGAT00000009776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIPVAHCFGPPGHYKRKFCTVCRKSLESPAFRCEVCELHVHTDCILFACSDCRQCHQDGH
QDHDTYHHHWREGNLPSGARCEVCKKTCGSSEVLSGMRCEWCGILAHAACYVVVTPECTF
GRLRSMILPPSCVQLFSRNFSKLHCFRISENLPTESADEGDDVDGSTQGPAKDVQISTDS
IFSKKPVFDGTSEXKNQTQECFTVLRTSRSESVLEAALRAYYINDDQQEYELQTFSQQAL
LSDDIINRNDAAEDSNLGSVFRESVPEAWIIRAKPKDEEVIRIYPAWLWEGMAYISLRVN
KDTTTQTVIKEVLPLLGRQTGCLQNFKLVEVLMGSKQVQRMVLDNQELILNRLEDIRKVY
LKAVGVSPFLQKKIVSVAPYVLLCILSCPPYSPCPLFLVTEKSNVVSVSHVYQAQGKQAL
HLMCAAEHEYLFRKLKDWSMDEGGCLTTLVPPAAQASKIPQNCWPLLVFVNPKSGGLKGR
DLLYCFRKLLNPHQVFELTNGGPLPG
Download sequence
Identical sequences G1N991
ENSMGAP00000008964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]