SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009069 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009069
Domain Number 1 Region: 10-223
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000106
Family Diap1 N-terninal region-like 0.068
Further Details:      
 
Domain Number 2 Region: 687-748
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0000256
Family Pancreatic carboxypeptidases 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009069   Gene: ENSMGAG00000008812   Transcript: ENSMGAT00000009882
Sequence length 755
Comment pep:known_by_projection chromosome:UMD2:12:13785494:13843939:-1 gene:ENSMGAG00000008812 transcript:ENSMGAT00000009882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VISKGGSEALLQALISAARTEPPDPSILLPLLRLLARVGQKDRKFGIKVQKAEATDVILS
LTRQNLGHHLNLTHCLWVLRVCASNGLVAAGTTLGINGAMELLFKVITPYSKQHIRTVRA
AIEALAALLKSKSNSRQAVNRGYLGGLLRLYQDWHHNDVSNNYIYIRRGLLLCLKHITNI
QLGRETFLGSRGMEILFTSVQDCLSCKNLDPIVTTVTQILRKCYPKEPLPLVTVRSSYSF
PLPGNVKTERPCMGSEDDNESDSEEDMEKDLNKDDVEGKEEDYDLETDVNKLRSRPGLDR
PEEELGQYEAMCPELSHDFQELDSESEEEKKSEDRSANLPSTSSHFIPSGNSVEDPNHRW
RNQSGTEAGSDPQEKDFKASLQSSIKKEKCSRSLISEKREIVEAVQNANSYEEDPAKSHT
FSPCPLPKEAPWYKKIFNPECEASIDPSSGVGSETTEIMTDLLEEHQGNIPFHSPHFYIA
RAKCTKSIPAYRDLAFPDFWGHQPPPHGTPMLDRHYGVQRDKVLDDVRRLIQPGDLIGRT
VFDLDEPSHSSPGAPCCLTFFSKFESGNLRKAIQVREFEYDLIMNADVNTNQHHQWFYFE
VRGMKLAVPYRFNIINCEKLNSQFNYGMQLVMYSVKEALQGRPRWLRAGHDISYYKNHYR
CSAAAGGSLKGKCYYTLTFSIKFPHEDDVCYLAYHYPYTYSAMMSHLDVLEQSRNPKKVY
WRQQALCQTLRGNTCPLLTITAMPESKKSDDLEQF
Download sequence
Identical sequences G1N9H9
ENSMGAP00000009069 ENSMGAP00000009069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]