SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009111 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009111
Domain Number 1 Region: 127-439
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.01e-94
Family Leucine aminopeptidase, C-terminal domain 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009111   Gene: ENSMGAG00000008864   Transcript: ENSMGAT00000009925
Sequence length 475
Comment pep:known_by_projection chromosome:UMD2:22:11881321:11892943:-1 gene:ENSMGAG00000008864 transcript:ENSMGAT00000009925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQLWQSALGTLNPNPTDSCPLYLNYATVAALPSRVSRHNSPSAAQFITRLVRNCLPGGVN
RCIVMVCERSEVFASACALARAFPLFTHRSSASRRTEKKTVTVEFFLVGQNNGPIEVATL
KCLASAAEGIRLAARIVDTPCNEMNTDNFLEEIKKVGKDLGITPTIIRDEELKERGFGGI
YGVGKAALHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAA
AILGAFKATVKQGFKDNLHAVFCLAENAVGPRATRPDDIHVLYSGKTVEINNTDAEGRLI
LADGVAYACKDLGADIILDMATLTGAQGIATGKYHAAVLTNNEEWEKACVKAGRNCGDLV
HPLVYCPELHFSEFTSAVADMKNSVADRDNTPSSCAGLFIASHIGFDWPGVWVHIDIAAP
VHAGERATGYGVALLLSLFGGASEDPLLNMVSPLGCNGDFPPDDMERDSKRRRLV
Download sequence
Identical sequences G1N9L4
ENSMGAP00000009111 ENSMGAP00000009111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]