SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009124 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009124
Domain Number 1 Region: 1970-2206
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-59
Family DBL homology domain (DH-domain) 0.0000241
Further Details:      
 
Domain Number 2 Region: 2205-2331
Classification Level Classification E-value
Superfamily PH domain-like 3.73e-29
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 
Domain Number 3 Region: 1779-1841
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000121
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009124   Gene: ENSMGAG00000008836   Transcript: ENSMGAT00000009938
Sequence length 2801
Comment pep:known_by_projection chromosome:UMD2:12:13948440:14071638:-1 gene:ENSMGAG00000008836 transcript:ENSMGAT00000009938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQCNGTVSPCSFFQGDSVITVQLTEEDKVEDDVVFYLIFTGSTVQHCTSTRKINPGSLET
ISPGHDCCETVKVALCASKEGRPVLVVAEESFKFIQDEAYDAAQFLATYAGNQQALNFTR
FLDQSRPPAADVDILDEKVALAFRHLKLPAEWNVLGTDQSLNENIPRETLMHFAVRQGLL
RLTWFLLQQPGGRGALSIHNRDGATPVSLALERGYQKLHQLLTEEEATEPDSWSTLSHTV
HTGDYCVKHHQQLDVYTLTAETKESHHRHQKQCLLGPVGPLFALLQSSRKWTQTVLGSSG
NSCGNGAEPVDHSTASSQSLGEMPEGRKESPSDAFHLDSGQLSDQPHQEDECPSRSLITR
VIDAPNSSLGLGAVESRVCSCESKNTVTLCKKEEEGPASAQCSGIVSDENGCTVSPCAGV
NGAVHLPSCGNTNEEAGMTSAGVVLDQASLCSKDSTHQEVGAAEECAAESTVAVVETAGE
APASREGVDVAMGQTECRNCAGAADRAPSQQQVKDGMAETPAMRTADPEEPLPAEEEPRS
AAQPLLDGFNGTECAGEAMEDSGAHNKEPVGTDTSSSREEVASFCPPVDQTAVNVETGDK
LKLDGIQGSTPFVIRNEESKQKQEVAAAGSAELAPPHGQERGGVASVLEDYAGAPGPPKQ
SLQSHAEGKDTAKPEREASDSSQEQVLSENLFAAVVKSSVGSAERSAASSDAGAGLKELG
PKQAGTAGAGDSIMQGIGPAAGSKPCLDAGLPQERGPSLQHVSPRSSTPELKDASEVEAP
SLAFEAEEALQIAAVTSITGYEEEQGEMESVLPRATLQPIAEEPTCDSDSSSDTMGPGGD
GDSAPTSTAAQGLVTAQPEAENPSSPGLPAEGKVGPEPQPAVDVAAGLNGEADLRSSARK
DVSQDIRGTKPATAFLCWCASSIASAKEGNSKVLSCVSAAEFSLQSGAVWSIFRISPAGD
MTSQCHKRCLGCPLSDTTVVKTNNKQAAKSGKLKMKTEGKKKKHCEDELTLQGGAPKTLL
IPQDVLQIETLLAAAGIQQPSPCLQELGMTSGWEGLQALGLTYPPSLVSAEKRGQSQNST
GRLPTAWGTADQVAGVLSLQSPLSPRFEKHRGMKRDIFLSNVLQSFSKDEKNGVKKKKRV
YIEVLVTKPMTPAMKAFRWHGRDWVWTLSLGKEKKNNMEAHSVLLCTMALRLPTSLTTKR
VLSSCTLAFQLVSLTKSSSQRKQTQPLPCIQWEEFQPLPATAALLSLPDCRLSSYKMEEK
ITFSFLTEGPASHLGAISCERGPVIKGERSFTNLKLASAPPNGTVAVWECLSPSQLFGAS
AVSWQTKIVPEKVVCKVTKKKPSAILRDRIAADEEGIFLSKVPKEAAKGMITGPQKPAQQ
NPTTNEINRESWCSLEPCPDSSLLERKRTGESPECENFLEDGLSSVCASSQGVLKRESGS
ESDFFSLPGDGMEDLVFGKQPEEEQSAGDITSSSSSADDTVSLERNSSLGSDTSLPFPPA
VSFAQPKDRRSLDGSCTSMVAVEGGEGELAGLGEKEEELDSITDVPAPSSVSRNSMRPLS
PFRRHSWGPGKNATNETEINQRSSMRILGDGIKKPPIHRRSYSLEGLAGDSGENKKPSAN
MEAASLSSKDLPRSALTSNQCGSLVLLTEELEQGEIRDYDHQIHQAPHPQGFNFCTSSVS
SSLTKSVSLMSISKPSLDNSEKINPSFHNCSASFEEEMEVETSYNFSISEESSSVPSIKS
GTKVSRTFSYLKNKMSSSKKSKEKEKDKEKTKEKDKDSKEKEKDKKMLNGHLFTATSVVT
QAICYHCMKPFNKDSYYCANCNAIVHKGCKESFASCAKVKMKPQRGMLQAHDTSSLPTVT
MRNKGSQPKERPRSAILAPDENTVTSIFNNRRSQQPTALSKSVSIQNIAGVGNDDSLIHT
WKFLSQSTDSLHKISRVNESTESLVDEGADMNEGQLMGDLELDSKQLEAESWSQAVDSLF
LQQQNKDVVKRQDVIYELMQTEMHHVRTLKIMNDVYSAGMLQELQYDQQVVDKIFPCLEN
LLHIHSQFFQRILERKKESLADKSEKNFVIKRIGDILVNQFSGENAERMKKTYGKFCGHH
NEAVNYFKDLSSKDKRFQAFVKKKMSSSLVRRLGISECILLVTQRITKYPVLLQRILQYT
AENEVEHEDLTQSLNLVKDVIAAVNSKVSNYEKKMRLDEIYNRTDSKSIMRMKSGQMFAR
EDLRHRKLIRDGPVSLKNAAGRLKEVQAVLLSDMLIFLQEKDQKYVFASLLKDQKSTVIS
LKKLIVREVAHEEKGLFLISMGVKDPEMVEVHASSKEERNGWIQIIQDTISTMDKDEDEG
VPCESEFEKKLSDTRIRALKEQLQQKDRQILLLLEEKAKIFSDMADSSMQEDMPGSRLLF
RANTEEAPKGEAIMKTAINEVELLQDLVNRNLGSTLVQQLSSAAIDEEGGVGPVSLPKRA
ETFGGFDSHQMNASKGGTKDEGDDAQDLRRTESDGVLKKAGNANLMFILKRNSEQVLQSV
TSLRKLLSALQGVVLQQDTYIEGQKLALSERALSRGFFRPASLLEQEKQRNLEKQRQELA
NLKKQQAQHQEEKRRAEKECEAREKKLAELEIQLAKREEEIQKGWQELECRRDELRQLKA
SYQLEMEKLHSKQKQLDKEWEQLRKDIERQPQMWLEHDDNQVSNRHEKLARVCSQSSLEG
TSKQKSPSFPKQGHSDAELSVSPKRNNLSRTHKEKSTSHLLSTTNQTNKAAEEQPQMPTR
LFSLSKPKEKKEKKKKGRGHRSQESDSHSSEAPPEGEEIFC
Download sequence
Identical sequences G1N9M4
ENSMGAP00000009124 ENSMGAP00000009124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]