SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009217 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009217
Domain Number 1 Region: 41-515
Classification Level Classification E-value
Superfamily Sema domain 8.89e-153
Family Sema domain 0.00000000000241
Further Details:      
 
Domain Number 2 Region: 1080-1342
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-79
Family Protein kinases, catalytic subunit 0.000000000246
Further Details:      
 
Domain Number 3 Region: 654-742
Classification Level Classification E-value
Superfamily E set domains 6.72e-18
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 
Domain Number 4 Region: 561-652
Classification Level Classification E-value
Superfamily E set domains 0.00000000000308
Family E-set domains of sugar-utilizing enzymes 0.047
Further Details:      
 
Domain Number 5 Region: 517-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000419
Family Plexin repeat 0.00018
Further Details:      
 
Domain Number 6 Region: 740-838
Classification Level Classification E-value
Superfamily E set domains 0.000000000077
Family Other IPT/TIG domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009217   Gene: ENSMGAG00000008925   Transcript: ENSMGAT00000010034
Sequence length 1382
Comment pep:known_by_projection chromosome:UMD2:1:25613531:25684768:-1 gene:ENSMGAG00000008925 transcript:ENSMGAT00000010034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPVTAYPSGIILFLFALLQRSHGQCKEAAKKSEMNLNVKYDLPNFITETPIQNVVLYKH
HVYIGAVNKIYVLNETLQNISVYKTGPILESPGCAPCEDCKDKANLSNSIWKDNVNMALL
LETYYDDQLISCGSMSGGVCHRHIIPPDNPADIESEVHCMYSPQVDGETENCPDCVVSTL
GTKVLVTEKDRFVNFFVGNTVTSAFQPPHVLHSISVRRLKETQDGFEFLTDQSYIDILPQ
FRDSYPVKYVHAFEHDHFVYFLTVQRESLDSQTFHTRIIRFCTLDSEMRSYMEMPLECIF
TEKRRKRSIRKEVFNILQAAYVSKPGAALAHEMGLGLNDDILYGVFAQSKPDSSEPTNRS
AVCAVSVRTINEFFNKIVDKQNMKCLQHFYGKDSKYCLNRAFSRNASYCRAQDDEYRLEV
TTPLQRVDLFMGQFNNILLTSISVFTKGNLTIANLGTSEGRFMQIVVSRSESTAPHVSFQ
LDSHPVSPQVVVEQSAAADGYTLVVTGKKITKVPLNGPGCHHFQSCSQCLLAPAFMRCGW
CGQRCLRASECGGGTWTQESCLPRVYEILPSSAPLEGGTKLTLCGWDFGFSKNNRFELRN
TVVHIGGQICALEAKSSNKNKLECTAPAAKSASFNISSSVSVGHGKTLFNTFSYVNPIIT
SISPTYGPKSGGTLLTIAGKYLNSGKSRRIFVGEKPCSLKSTSESTVECYTPAQGIPQEY
RVRVGIDGAIRDAKGYFTYREDPVVLKIHPAKSFLSGGSTITAQGINLNSVCFPRMVITV
PKLGMNFSVACNHRSSSEIICCTTPSLKAFNLQPPFVTKVFFIFDGVSSLYFDFDYVNNP
VFKHFEKPVFISRSNPNVLEIKGNYIDSEAVKGEVLKVGNKSCENLLLQSETILCTVPSD
LLKSNSELNIEWKQEVLSTVIGKVLIRQDQNFTGLIAGVVSTSVLIFIFLVFFLWRRKKK
QIKDLGSELVRYDGRVHTPHLDRLVSARSVSPTTEMVSSESVDYRSTFLEDQFPSMSQNG
SCRPAQYPHSDLSPILSSGDSDLASPLLQTNVHIDISALNPDLVKEVQHVVIGADSLIVH
FSEVIGRGHFGCVYHGTLLDNDGRKIHCAVKSLNRITDLEEVAQFLKEGIIMKDFTHPNV
LSLLGICLPNEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNSFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKPEMRPAFSELVSKISTIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSTQDNTDMDV
DT
Download sequence
Identical sequences G1N9U2
ENSMGAP00000009217 XP_003202025.1.16129 ENSMGAP00000009217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]