SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009301 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009301
Domain Number 1 Region: 177-273
Classification Level Classification E-value
Superfamily AMPKBI-like 3.4e-35
Family AMPKBI-like 0.00000735
Further Details:      
 
Domain Number 2 Region: 81-164
Classification Level Classification E-value
Superfamily E set domains 4.48e-28
Family AMPK-beta glycogen binding domain-like 0.00000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009301   Gene: ENSMGAG00000009024   Transcript: ENSMGAT00000010120
Sequence length 273
Comment pep:known_by_projection chromosome:UMD2:17:10198934:10204431:-1 gene:ENSMGAG00000009024 transcript:ENSMGAT00000010120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTSSERAGLERHGHKASRADGAGGAGGTKDGDRPKILMDSPEDADLFHSEEMKAPLDK
EEFLAWQQDLEVSDKTPTQARPTVFRWTGGGKEVYLSGSFNNWSKIPLTRSHNNFVAILD
LPEGEHQYKFFVDGQWTHDPSEPVVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDMS
ELSSSPPGPYHQEPYVCKAEERFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLN
HLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences G1NA04
ENSMGAP00000009301 ENSMGAP00000009301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]