SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009411 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009411
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.17e-16
Family Glutaminyl-peptide cyclotransferase-like 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009411   Gene: ENSMGAG00000009140   Transcript: ENSMGAT00000010233
Sequence length 119
Comment pep:known_by_projection scaffold:UMD2:GL428438.1:259:1476:1 gene:ENSMGAG00000009140 transcript:ENSMGAT00000010233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVLLDLLGAQNPAIHSHFPQTHHWFLRLVAIEKRLRRLGLLHASPHDQPFFRLSPAPGP
VEDDHIPFLQRGVPVLHLIPLPFPWVWHTTEDNEDNLHPPTMEDLCKILTAFVAEFLQL
Download sequence
Identical sequences H9H1J6
ENSMGAP00000009411 ENSMGAP00000009411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]