SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009429 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009429
Domain Number 1 Region: 73-244
Classification Level Classification E-value
Superfamily E set domains 2.52e-32
Family Arrestin/Vps26-like 0.015
Further Details:      
 
Domain Number 2 Region: 4-71
Classification Level Classification E-value
Superfamily E set domains 0.00000000000658
Family Arrestin/Vps26-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009429   Gene: ENSMGAG00000009134   Transcript: ENSMGAT00000010251
Sequence length 315
Comment pep:known_by_projection chromosome:UMD2:12:16456675:16461436:1 gene:ENSMGAG00000009134 transcript:ENSMGAT00000010251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEGLVLLDGRHEFPFSFQLPQEPLVTSFTGKYGSIQYYVKAILERPAAPDQSVQTELQVI
SHIDVNSPALLTPVLRSQEKMVGCWFFTSGPVSLSAKIERKGYCNGEAIPIYAEIENCSS
RLIVPKAAIFQTQTYLASGKTKTFRQMVANVRGNHIASGSTDTWNGKTLKIPPVSPSILD
CCIIRVEYSLAVYIHIPGAKKLMIEMPLVIGTIPCIGFSSRNSSITSQFSMDMSWLALTL
PEHPEAPPNYADVVSEEEFSRHVTAYPPPIDCEEQLCCPVFAYIQEFRFQPPPLYSEVDP
HPTDVEEFQPVSLML
Download sequence
Identical sequences G1NAA2
ENSMGAP00000009429 ENSMGAP00000009429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]