SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009590 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009590
Domain Number 1 Region: 51-128
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000262
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 2 Region: 209-355
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000245
Family Spectrin repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009590   Gene: ENSMGAG00000009304   Transcript: ENSMGAT00000010419
Sequence length 655
Comment pep:known_by_projection chromosome:UMD2:7:15461249:15487094:1 gene:ENSMGAG00000009304 transcript:ENSMGAT00000010419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNEASLEQKLSTTTLSSVAVQAGNASIVIAVLKCGKWVKLQLAESTPNLLEIGSNQDEA
KKLLQDHELLLTKLKALEDQVWDLLHEADKAAEENKEKSQVYDAMAETLGDAWDALVIML
EKRQALLELTTVFFENALEFAVKIDQVEDFVKNAQEFDNVDSLRELLQQQEHHTKELLEK
SLALLNKSHELTEFIEEFKHEGPNANPELIQGAQSSCLKIDNLLELLQDRRRQLDRSLKH
QRRGLEQVLQICLWHQQENQVTSWYEKNIRDYIQKQNLGSSLLENEELLQEHKEMEVRVK
EWNSTVEQLEAEALNILLSEDYTEKEHLNISNQKIYLLRGEVCCHMEERKALLQEANDFF
NTADKIFEAVNALENYLKIFNSEDLSLPVLSMKYDELKEEIKGCTASMLQKGQTLINKAD
SHSSWVIGIQKMIEKVNKKEDQLIRQCPDDKELMLKKQQWTASLEDHLNKVSQSIKKITS
MLAVGVEVGSHLSESERILNEHLELANQIKETSCELGEAEGIIKDMREFEPEQVAAFYSK
TDFLNEELKKTERNIRTKIEILTTYVAFLKSSLEMNDYIQNLKEFYHAEPLQTSKEAENK
NAIESVNTKWQKSIEKFFSTENLGRIFLNLVNTVSEGFILKVEKSVQVIEETIIN
Download sequence
Identical sequences G1NAM6
ENSMGAP00000009590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]