SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009648 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009648
Domain Number 1 Region: 349-525
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.67e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000124
Further Details:      
 
Domain Number 2 Region: 527-627
Classification Level Classification E-value
Superfamily E set domains 2.64e-31
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009648   Gene: ENSMGAG00000009346   Transcript: ENSMGAT00000010479
Sequence length 875
Comment pep:known_by_projection chromosome:UMD2:22:14157587:14201985:1 gene:ENSMGAG00000009346 transcript:ENSMGAT00000010479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEPTPHKTNSPPSGVAYAHDVLDCGLKPCPLPFPSLSADPMGRYGQPDSIGTAPTHPASA
AGASAPSPRIEITSYPELINSGGPFRSRDTNVLLVEHQSNSATTSPRVTLPVPGFEGYRE
PLCLSPASSGSSASFISETNLSPCTSPCVSPNNGPSDDLCPQFQNIHTHYSPRTSPIMSP
RTSITEETCLGQHSPSPRPNSRSSSPGAKRRYSCTQQPSTSPRQSRTPSPQSSPRIPLRE
DSSTLTYTQLSSAPLSMDAMNSLPTDPSCGVPTKIWKTSPDPSSMPSHKNSIPCHVFQTV
DFHGPCEQEDRRNSAPESILLVPPSWTKQLMPAIPICSLPVQSLPPLEWPLSSQSGSYEL
RIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKP
HAFYQVHRITGKTVTTTSYEKIIGNTKVLEIPLEPKNNMKATIDCAGILKLRNADIELRK
GETDIGRKNTRVRLVFRVHIPESSGRIISLQAASNPIECSQRSAHELPMVERQDIDSCLV
YGGQQMILTGQNFTAESKVVFTEKTSDGQQIWEMEATVDKDKSQPSMLFVEIPEYRNKHI
RTPVKVNFYVINGKRKRSQPQHFTYHPVPSIKTEPIDDYDPALICNTVHSGLGTVTQPYY
SQHTMVTESPSCLVATMAPCQQLRSGLSSPDSRYHPQNPAAVVYQRSKSLSPSQLGYQQS
GLMATPVAISDAHRSVLVHAGSPGQTSAVLHHSPGNQQSSPVIHYSPTNQQLRCGSHQEF
QHIMCCENFTSSVARPSQPQVSQAQRLSPSSYPTVIQQQTASGQRGAKNGQPVSDQKEVL
PAGVTIKQEQNLDQAYLDDARKFIFVLYSIKRNQT
Download sequence
Identical sequences G1NAS0
ENSMGAP00000009648 ENSMGAP00000009648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]