SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009666 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009666
Domain Number 1 Region: 376-499
Classification Level Classification E-value
Superfamily EF-hand 1.48e-47
Family EF-hand modules in multidomain proteins 0.00000864
Further Details:      
 
Domain Number 2 Region: 502-595
Classification Level Classification E-value
Superfamily EF-hand 1.9e-31
Family EF-hand modules in multidomain proteins 0.0000259
Further Details:      
 
Domain Number 3 Region: 577-663
Classification Level Classification E-value
Superfamily RING/U-box 7.53e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 214-335
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 5 Region: 338-375
Classification Level Classification E-value
Superfamily WW domain 0.0000000000114
Family WW domain 0.00021
Further Details:      
 
Domain Number 6 Region: 88-222
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000072
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009666   Gene: ENSMGAG00000009349   Transcript: ENSMGAT00000010498
Sequence length 951
Comment pep:known_by_projection chromosome:UMD2:4:31339300:31349942:1 gene:ENSMGAG00000009349 transcript:ENSMGAT00000010498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLVMQEWPFVVPRCPEWRVAELARRGSAAHPLSQVKAPVPSSVSAQDGTGPSCVTPWV
PDSAAGPQAPLEMNLCWNEIKKKSHSLRARLEAFSDHSGKLQVPLQEIIDWLGQKDEELS
AQLPLRGDVLLVQQEKETHAAFMEEVKSRGPYIYSVLESAQAFLSQHPFEELEEPNSESK
DVSPRHRIQNISRFVWKQANVASELWEKLTARCVDQHRHIERTLEQLLEIKGAMEELSTA
LDQAESVRETWEPIGDLFIDSLPEHIQSTKLFKEELSPMKDGVKVVNDLAHQLAISDVHL
SMENSRTLEQINTRWKQLQASINERLKQLQDAHRDFGPGSQHFLSSSVQVPWERAISPNK
VPYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDMVTLATA
LEIFNEHDLQPSDRAMDVVEVIHCLTSLYERLEEERGILVNVPLCVDMSLNWLLNVFDSG
RSGKMRALSFKTGIACLCGTEVKEKFQYLFSQVANAGGLCDQRHLGVLLHEAIQVPRQLG
EVAAFGGSNVEPSIRSCFRFSHGKPAIEAAQFEWANLEPQSMVWLAVLHRVTMAEQVKHQ
TKCSVCRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPTTSSENMR
DFATTLKNKFRSKQYFSKHPQRGYLPVQSVLEADFSETPASSPMLPHADTHSRIEHFASR
LAEMENQNCSFFSDSLSPDDSLDEDQYLLRHSSPITDREPAGSQQVPGSLPMDDKGELER
ILAHLEDENRILQGELRRLKWQHDEAVESPTLATSSPESVQDPRNEELLAEARILRQHKS
RLETRMQILEDHNKQLESQLHRLRELLLQPPAESNGNGSAASSLASSPHQSEGSQAKDKE
HDTPDTEAAADEVEAKTQEVSVCLEDIMEKLRSAFPNSRGTRVKSPSLASY
Download sequence
Identical sequences G1NAT5
ENSMGAP00000009666 ENSMGAP00000009666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]