SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009683 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009683
Domain Number 1 Region: 2-267
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.55e-63
Family Pancreatic carboxypeptidases 0.00000118
Further Details:      
 
Domain Number 2 Region: 267-348
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 4.12e-20
Family Carboxypeptidase regulatory domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009683   Gene: ENSMGAG00000009366   Transcript: ENSMGAT00000010515
Sequence length 379
Comment pep:known_by_projection chromosome:UMD2:8:24288750:24293112:1 gene:ENSMGAG00000009366 transcript:ENSMGAT00000010515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEPEFKYVGNMHGNEVLGRELLLQLSEFLCEEYRRGSERVTRLLHDTRIHIMPSMNPDGY
EVAANQGPDGIGYLTGRNNANGVDLNRNFPDLNTFMYYSGEISGPNHHIPLPDNWKSQVE
PETLAVIQWIGSYNFVLSANLHGGAVVANYPYDKSQDQRFRSHRRTANTPTPDDKLFQKL
AKTYSYAHGWMHRGWNCGDYFVDGITNGASWYSLSKGMQDFNYLYTNCFEITLELSCNKF
PPKEDLERQWMANREALVAFIEEIHQGIKGMVTDENNNGIAGAVISVQGISHDVTSGEMG
DYFRLLLPGTYTITASAEGYQPQTVTATVGPAAPSLVHFQLKQDVVKKASERKASGTHTN
NKTLQKKVVPRAVRRGTQR
Download sequence
Identical sequences G1NAU7
ENSMGAP00000009683 ENSMGAP00000009683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]