SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009699 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009699
Domain Number 1 Region: 735-944
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-47
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 979-1176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.67e-42
Family BAR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 241-304
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-17
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 4-62
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-16
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1446-1505
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-16
Family SH3-domain 0.0000633
Further Details:      
 
Domain Number 6 Region: 142-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000236
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1248-1322
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.00000984
Further Details:      
 
Domain Number 8 Region: 68-125
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000827
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009699   Gene: ENSMGAG00000009389   Transcript: ENSMGAT00000010531
Sequence length 1508
Comment pep:known_by_projection chromosome:UMD2:8:24303543:24325133:1 gene:ENSMGAG00000009389 transcript:ENSMGAT00000010531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAVFDFCPSVSEELPLFVGDVIEVLEVVDEFWLLGKKEGVTGQFPSSFVELVD
IPLLKQGEKLFVCTSDFTSQEPGSLPLQRGDLVILGGSLASSWLQGRSSWGSKGFFPSSC
VRELCLSVRSRQLSHSSLLEVPAYSLGQARALMGLSAQLEEELDFREGDVINIIGIPEPG
WFEGELRGHRGIFPEGFVELLTPLRAAGTSEDQEPAGTCDTNGTVPTKQEEDGREDERQE
PGSTYGVALYQFQALESEELDFEVGDRIRIVGILEDGWLEGELRGKRGIFPHRFVRLEAS
DPCREKVGAGDSQAGGSCEVTVHQDLESTCSRVLPLPEKDSWNKEDGLVAHPEPDAVVSH
IAGRSEAPLGTDLRQHQAFPDTGLQELHPKTTADSLPFECTKTVNGLLPSTQLPPQQSSE
LGQAGVLEPPALPEHDGSGPTVPPQPPCFPPDICGSQAISPPNSWAASEPQENRSSIQDL
DGWVDNQQKSKPCSSSWGGVHTGPDTWAGSWGECSSLAAQGHSGTDLDSKLTEQLVQFEK
SLSSTSAEQDKVSRHFSILDYSSEKDIVRGSPECVPHAKLPERRKALRPPPPRPSTLATT
PVPKGRSLSFSVKPSRPAPRPPSSSQRRSMVPPQLQPNVAEQHMEESREDATRTGSTSPC
SILLMRIGEVERDLEAYRKTRTELSLLLEEQQDEPVRTETLENLDFCDSNIESLSVELQE
LREMTLLSSQTPSLETSSSVTESPEHRMLEKRSKVIEELLQTERDYIRDLEMCVERIMVP
LQQAQVLNVDFEGLFGNIQVVISFSKQLLLTLEASDSIGPVFLAQRAELESIYRVYCQNH
DEAIALLETYEKDEKIQKLLVDLLDNLRSLYSEWGCTNYINLGSFLIKPVQRVMRYPLLL
MELLSATPESHPDKAPLTAAVLAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLN
FHSIIKKSNRVSSHLKHLTGFAPQLKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHVRE
SACMKALAAVSMWDLCMEKGSGDLDQFQKVNRLISDQLFSNFKERTERLVISPLNQLLSM
FVGPHKLVQKRFDKLLDFHNCTERAEKLKDKRTLEELQSARNNYEALNAQLLDELPKFLC
FAKELFASCVRGYAEAHCDFVRLALEELRPLLSLLKTSGREGNLIAIFQEEHSRVLQQLQ
AFTFFPESQAVPRKPFERKTVERQSARRQPLGALPSYVLQSDDIRAALLARYPPESLFQA
DRNFNAAQDLDVSLLEGDIVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSQ
SDVSVGSHSSNESEHSSSSPHSSTMLTFSTNRAAVAFAHKPSQDSALLGELCHSPQSPSE
MDSPSSGDRTVPLEAGVVTSPHRYSRPEPGYSPSPRNEHPTKAHLRSASLVEDRDSGLES
GESEGNQVYYALYTFKGRNTNELSVSANQRLRILQFEDITGNQEWWLAEAHGKQGYVPSS
YIRKTEYT
Download sequence
Identical sequences G1NAV8
ENSMGAP00000009699 ENSMGAP00000009699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]