SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009708 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009708
Domain Number 1 Region: 276-358
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000104
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009708   Gene: ENSMGAG00000009408   Transcript: ENSMGAT00000010540
Sequence length 362
Comment pep:novel chromosome:UMD2:17:10600234:10604402:-1 gene:ENSMGAG00000009408 transcript:ENSMGAT00000010540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEENIYKACLPGPGIFQCSETGLAFEVQSAASIVYRYASWSTHLKEADQNVWVPAGPLFN
IWALPGTVRAVHLPHFICLSDADISGCSIAHFEFQKMTIQQPTEVMAFSAVLENPSFSLV
GVVWRKLRSAISLPMHSLVLIFHQLSAANTTLHLYLIPDDISVKKAIERQEMSWNSKLIP
KPPPFSPLFFGNRYQVSSNAQVKITPGTHLPFCYKSPKDQQLFVEIYIRNMAEEIEFFIT
DGQNDTEVWRASLRSERVSISVMVYFISSLLSLSGAAFLKKHKTELCSRMGQLSSILLNL
RVGDVINSEEEEEVQAQNTKQKKNQFLLDLVERKGPNAQQKLFQVLRTKDPFLVEHLENK
QL
Download sequence
Identical sequences G1NAW5
ENSMGAP00000009708 ENSMGAP00000009708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]