SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009712 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009712
Domain Number 1 Region: 268-353
Classification Level Classification E-value
Superfamily DEATH domain 4.05e-16
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009712   Gene: ENSMGAG00000009408   Transcript: ENSMGAT00000010544
Sequence length 355
Comment pep:novel chromosome:UMD2:17:10600561:10604402:-1 gene:ENSMGAG00000009408 transcript:ENSMGAT00000010544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEENIYKACLPGPGIFQCSETGLAFEVQSAASIVYRYASWSTHLKEADQNVWVPAGPLFN
IWALPGTVRAVHLPHFICLSDADISGCSIAHFEFQKMTIQQPTEVMAFSAVLENPSFSLV
GVVWRKLRSAISLPMHSLVLIFHQLSAANTTLHLYLIPDDISVKKAIERQEMSWNSKLIP
KPPPFSPLFFGNRYQVSSNAQVKITPGTHLPFCYKSPKDQQLFVEIYIRNMAEEIEFFIT
DGQNDTEVWRASLRSGDFSHSRNDSKTPSGAAFLKKHKTELCSRMGQLSSILLNLRVGDV
INSEEEEEVQAQNTKQKKNQFLLDLVERKGPNAQQKLFQVLRTKDPFLVEHLENN
Download sequence
Identical sequences G1NAW9
ENSMGAP00000009712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]