SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009778 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009778
Domain Number 1 Region: 791-1051
Classification Level Classification E-value
Superfamily RNI-like 2.88e-62
Family 28-residue LRR 0.011
Further Details:      
 
Domain Number 2 Region: 614-789
Classification Level Classification E-value
Superfamily RNI-like 1.04e-34
Family 28-residue LRR 0.025
Further Details:      
 
Domain Number 3 Region: 1-59
Classification Level Classification E-value
Superfamily DEATH domain 0.00000895
Family Caspase recruitment domain, CARD 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009778   Gene: ENSMGAG00000009451   Transcript: ENSMGAT00000010613
Sequence length 1059
Comment pep:known_by_projection chromosome:UMD2:16:13340121:13348233:1 gene:ENSMGAG00000009451 transcript:ENSMGAT00000010613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRLDLLTVEEAGRAQEASSLPEQVRAVVDILAGKGSHASQSLQSFIETTNSQLYLHITV
YEPMVQKHLESLQSFYGNSLEIGSLQRLTNLLLVEGLTDIQQKEHDILQMEMTKGLQNVS
KSIPLEKLFLPLSKVSIPPRISVTTGVAGIGKSTLVKLFVGRWTKGLINRDIMFVLPLTF
RELNTYEKLSAERLIRSSFPHITEPNCISTGAARTLLILDGLDEFKTPLDFSNTVACTDP
KKEIQVDNLITNIIRGNLLQEASVWVTSRPTAASQIPGGLIDRMTEIRGFRAAEMKDFLD
QMFLDNRDLSSQVLHHIKANRSLHIMCTVPGFCRIYGSSIGYYLKNSTGQPQELTVAPKT
LSEIYSYYFKMALSSDWPERQRETLRIEQAVNNSKKVMGSLGRLAFYGLLKRKHVFYEQD
MKTYGIDLSLLHSSLCSRLLLKEDMQSSTAYYFSHLTIQEFLAAIYYYTAAKRAIFDLFT
ESGMSWPKLGFLNHFKSAVQRSLQAEDGQLDIFVRFLSGLLSPQVNQLLSGWLLVKDEHN
SYRNQAISFLQGCLNTNYVISSQTVNTVHCLHEIQHTEIAKAVEEAMKNESLAGMLTPVN
CSALAYLLQVSDVCVEETNLSNCLTYNICKSLLPQLLFCHSLRLDNNQFKDNVMELLGSV
LSVKDCQIQRLSLAENQICNKGAKALARSLMVNRSLTALDLRSNSIGPSGAKALADALKK
NQVLLSLNLQHNVIKEEGATALAEALLTNHRLITLHLQKNSIGAHGAKKLAEALAQNCSL
KELMLSSNSXALAEALKVNHSLQSLDLQSNSISNTGVSALTAALCSNKGLIDLNLRENSI
SKEGGPAIAHALRTNCTLKKLDLAANLLHDEGGKAIALAMKENQALTSLHLQWNFIQTQA
AVALAQALQSNGSLASLDLQENAIGDEGMAALAAALKVNTTLADLHLQVASISAAGAQAL
AEALMVNNSLQVLDLRGNSISVAGAKAMANALKVNRSLRWLNLQENSLGMDGAICIATAL
RGNHGLTYVNLQGNRIGQSGAKMISDAIRTNSPDCVVVV
Download sequence
Identical sequences G1NB21
ENSMGAP00000009778 ENSMGAP00000009778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]