SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009784 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009784
Domain Number 1 Region: 267-538
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-76
Family Protein kinases, catalytic subunit 0.000000000795
Further Details:      
 
Domain Number 2 Region: 165-311
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-35
Family SH2 domain 0.0000448
Further Details:      
 
Domain Number 3 Region: 94-163
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-18
Family SH3-domain 0.0000675
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily PH domain-like 6.89e-16
Family Pleckstrin-homology domain (PH domain) 0.0000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009784   Gene: ENSMGAG00000009438   Transcript: ENSMGAT00000010619
Sequence length 549
Comment pep:known_by_projection chromosome:UMD2:4:31415479:31422787:-1 gene:ENSMGAG00000009438 transcript:ENSMGAT00000010619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLYVFSPTEELRKRWIHQLKSVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCKILE
SRNGSLKAGRSHRKTKKPLPPTPEEDMMVMKPLPPEPAPSAAGEMKKVVALYNYVPMNVQ
DLQLQKGEEYLILEESHLPWWKARDKNGREGYIPSNYVTETSNSLEIYEWYSKNITRSQA
EQLLKQEGKEGGFIVRDSTSKTGKYTVSVYAKSAVDPQGMIRHYVVCCTPQNQYYLAEKH
LFNTIPELITYHQHNSAGLISRLKYPVSRHQKSAPSTAGLGYGSWEIDPKDLTFLKELGT
GQFGVVKYGKWRGQYNVAIKMIREGSMSEDEFIDEAKVMMNLSHEKLVQLYGVCTKQRPI
FIITEYMANGCLLNFLRETQRRFQPAELLEMCKDVCEAMEYLESKQFLHRDLAARNCLVN
DQGIVKVSDFGLSRYVLDDEYTSSMGSKFPVRWSPPEVLLYSKFSSKSDVWSFGVLMWEV
YSLGKMPYERFNNSETTEHVIQGLRLYRPQQASERVYAIMYSCWHEKAEERPTFTALLGS
IVDITDEEP
Download sequence
Identical sequences G1NB26
ENSMGAP00000009784 ENSMGAP00000009784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]