SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009789 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009789
Domain Number 1 Region: 323-428
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000446
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 101-199
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000249
Family CRAL/TRIO domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009789   Gene: ENSMGAG00000009434   Transcript: ENSMGAT00000010624
Sequence length 561
Comment pep:known_by_projection chromosome:UMD2:11:16270470:16304047:1 gene:ENSMGAG00000009434 transcript:ENSMGAT00000010624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVNCLKDARSLSPKQNRKYNRLLISVFTCADEIMQQEIRPLVAVDIIEQLHRQFAILSGG
RGKDGAPIITFPEFAGFSEIPDEDFLNVVTYLTSIPSLEAASIGFIIIIDRRRDKWSAVK
ASLTRIAGAFPGNLQLVFVLRPSRFIQRAIADIGIKLYRDDFKMKVPIIMLNSVSDLHGY
IDKCQLTRELGGTLEYGHSQWIHHRTAIENFAMTVKTTAQMLQTFGTDLAETELPNDVQC
TEELLSAHTDHHSKLKDELKLAVKQGATLLTCIREPVTRSANSKLSPDELENVATVERLL
AQLDETEKAFDQFWTKHHLKLEQCLQLRHFEHDFREVKLILDNLMEAQAGFSDVGDSVTR
VEHLLREQKQLEEKGQEPLEKAQTLALHGEQLIQNNHYAVDSIRPKCVELRRICDDFTNE
TKKKYDILGKSLELHKQLDKASQWCEAGIYLLASQAVDKCQSQEGAETALVEIEKFLATA
KEHQLSNPKEFYNQFDTILTPEIKANAQRILQKLEDVQEMFDKRQVSLKKLAAKQTRPVQ
PVAPHPESSPKRASPKTTRPA
Download sequence
Identical sequences G1NB31
ENSMGAP00000009789 ENSMGAP00000009789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]