SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009807 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009807
Domain Number 1 Region: 269-421
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 159-267
Classification Level Classification E-value
Superfamily Second domain of FERM 1.24e-23
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 3 Region: 72-157
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-18
Family First domain of FERM 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009807   Gene: ENSMGAG00000009466   Transcript: ENSMGAT00000010642
Sequence length 1051
Comment pep:known_by_projection chromosome:UMD2:14:16104704:16167929:-1 gene:ENSMGAG00000009466 transcript:ENSMGAT00000010642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTSQPGGTRRFAGTMASVLMCGVEDLLLGGSRCVWTLTVTALRRWYAGRLRACRQALRA
WCGLGDVYQMTEGRHCQVHLLDDRNLELLVQPKLLSRELLDLVASHFNLKEKEYFGITFI
DDTGQSVWLQLDHRVLDHDLPKKPGPATLYFAVSRFYIESISFLKDKTTVELFFLNAKSC
VHKGQIEVESETVFKLAALVLQEAKGDYSSDENTRKDLKTLPVFPTKTLQEHPSLAYCED
RVIEHYTQIKGLTRGQAIVQYMRVVEALPTYGVHYYGVKDKQGIPWWLGISYKGIGQYDL
QDKVKPRKLFQWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLVVQTWYANTSLIK
SIWVMAISQHQFYLDRKQSKAKIPSARSLDDIAMDLTEMGTPKVSKLVTLEAKNQLIMAS
NGSLISSGSQDSEVSEEQKKEKIMELKKKEKLLQEKLLQKVEELKKICLREAELTGKMPK
EYPLSAGEEPPQVRRRVGTAFKLDDNLLPTEEDPALQELESNFIIQQKLVEAAKKLASEP
DLCKNVKKKRKQEYADAVKKLQEIENSINEYRIKCGKKPTQKSTLTLPDDIIPSESSSLS
DTTTYDDGSESLSVPAQRTSSAQLSPRLLPPKSLGLERVHLRKSSMNEQLLESRHSRDPL
STHSSPYRTLERAAPSHGGRSMPTTPVLTRNAYSSSHLQPDVSPHHCRQRSGSLESQTHL
LAEVPTEKTAFSLTKSQRSSSTEILDDGSSYTSQSSTEYYCVTPTPKPYYTTQTLDNRTR
GRRRSKKQHISAAGSGSMPNLAQKDVRNGVYHKSQEQPSSSYYISGYSPYTESDVYYNGG
YVYESDTEGQYSVNPSYRSSAHYGYDRYREFRSYNEDEVDRVPHNPYATLRLPRKQVAKT
EHITKNIHKALVAEHLRGWYQRASSQKEQGHCLQAGFESDRGSQRSLGFAGLQVPCSPSS
RVSSFSSASSANTSGNWRNPLALGLSDYDTLSHSSFASCYGNTYGNLPLQSRVYPEPSQL
GGDEENQLEEDLHNSEQRLFWHEDSKPGTLV
Download sequence
Identical sequences G1NB47
ENSMGAP00000009807 ENSMGAP00000009807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]