SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009860 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000009860
Domain Number - Region: 16-108
Classification Level Classification E-value
Superfamily E set domains 0.00098
Family Arrestin/Vps26-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009860   Gene: ENSMGAG00000009553   Transcript: ENSMGAT00000010697
Sequence length 108
Comment pep:known_by_projection chromosome:UMD2:1:31644115:31647774:-1 gene:ENSMGAG00000009553 transcript:ENSMGAT00000010697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVKAINLVLPEVKVYPVGSSICGQLVLNLSSTLVDPVVKMELMGRGYLKWPEGNPELD
YEEIIVCTNKAVYISKAKKFHIADSCLDSGIHTFDFHFSFPPEAPSTF
Download sequence
Identical sequences G1NB88
ENSMGAP00000009860 ENSMGAP00000009860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]