SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009926 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009926
Domain Number 1 Region: 29-204
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.51e-38
Family MHC antigen-recognition domain 0.00033
Further Details:      
 
Domain Number 2 Region: 202-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000622
Family C1 set domains (antibody constant domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009926   Gene: ENSMGAG00000009608   Transcript: ENSMGAT00000010767
Sequence length 259
Comment pep:novel scaffold:UMD2:GL429735.1:620:2524:1 gene:ENSMGAG00000009608 transcript:ENSMGAT00000010767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPHAILLLFFFFPGTWAEPEALFPSPAGSHMLKLLHFATFQNSTSVLVGGVGLLGDVEM
GSLDSRTGNIHYYLPWMRPSLPKGDWEVIESSIKSYVRDFSKLVQMYATVPYPFVFQTSV
GCELYSNETIRTFFDIAYNGQIFLRFRLDTGTWDQMQHNQLAAIAEHLMVNASTLNEVIQ
VLLGDTCVEVLRIFIQAGKADLERQVPPIAVVFARTAGPAQLLLVCRVTSFYPRPITVTW
LRDGKELPPSPALSTGTVL
Download sequence
Identical sequences H9H1M1
ENSMGAP00000009926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]