SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010020 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010020
Domain Number 1 Region: 48-160
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.57e-38
Family Frizzled cysteine-rich domain 0.0000742
Further Details:      
 
Domain Number 2 Region: 176-302
Classification Level Classification E-value
Superfamily TIMP-like 8.83e-26
Family Netrin-like domain (NTR/C345C module) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010020   Gene: ENSMGAG00000009698   Transcript: ENSMGAT00000010863
Sequence length 311
Comment pep:known_by_projection chromosome:UMD2:8:24537059:24539356:1 gene:ENSMGAG00000009698 transcript:ENSMGAT00000010863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRQSGAGGSAGVLTRALALARGEGQHYDYYGWQPENVPRGRFYGREPQCVDIPADMQLCH
DVGYKRMRLPNLLEHESMAEAKQQASSWVPLLAKQCHADTQLFLCSLFAPVCLDRPIYPC
RSLCEVVRDACAPVMESYGFPWPEMLHCGKFPSDHDLCITVQFGNNQATPPPVPKICTQC
EMEHKADGMMQQMCSSDFVVKMRIKEVIEENGERRLVAAQKKKVLKLGPLKRKDTKKMVL
HMRNTGSCPCPQLDNLSGSFLVLGRKVGGRLLLLAIYPWRKHNKEMKFAVKFMFSYPCPL
YHPLLYGAGQH
Download sequence
Identical sequences G1NBK0
ENSMGAP00000010020 ENSMGAP00000010020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]