SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010117 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010117
Domain Number 1 Region: 324-451,723-898
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.55e-51
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 1108-1171
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6e-19
Family SAM (sterile alpha motif) domain 0.0028
Further Details:      
 
Domain Number 3 Region: 229-293
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.63e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000769
Further Details:      
 
Domain Number 4 Region: 164-220
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000464
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0079
Further Details:      
 
Domain Number 5 Region: 126-178
Classification Level Classification E-value
Superfamily PH domain-like 0.00000722
Family Pleckstrin-homology domain (PH domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010117   Gene: ENSMGAG00000009749   Transcript: ENSMGAT00000010963
Sequence length 1172
Comment pep:known_by_projection chromosome:UMD2:4:31663804:31675147:1 gene:ENSMGAG00000009749 transcript:ENSMGAT00000010963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLGAGGSPPKXGSISPPQGCPPPPPEESSDSEGEQEGSTHKLIRKVSTSGQMRSKHRVNK
GETSGSREMPGLAARRAGAEPGRARRVAQLIRFAASRSPSPTGALVARGQTQRIPLRAHG
VMLVRCRAFCSDSGKEMEDWIGALKSVQKWEIHEATQFNMEHFSGMHNWYACSHARPTFC
NVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGSEIIEDEDGVAMPHQ
WLEGNLPVSARCAVCDRTCGSVRRLQDWRCLWCKAIVHSACKEQFGRRCPLGQYKVSIIP
PTALNSIDSDGFWKATCPSSCSSPLLAFVNSKSGDNQGVKFLRKFKQFLNPAQVFDLMNG
GPHLGLRLFQKFSTFRILVCGGDGSVGWVLSEIDALGLHKQCQLGVLPLGTGNDLARVLG
WGSLCDDDTQLLQILEKLERATTKMLDRWSVLTYEAPKQSPPALKEEEDGDSNIQAHISH
YADSVAFHLAKILESDKHSVVISSAKFLCGTVNDFVAEVGRAYKRATENKQEAELMARKC
AMLNEKLDSLVRELTEEAQAIVVPEGTPQGTPTDAKELEKGGFVPSPVPRIFKSKEQLML
RANSLKKALRQIIEQAERAVDEQNKQTQAYQATAVPSKKDSSEELNKEEERLCKAPIWHA
ASFREGCLGEQRGGLTQQPPPTHPAGSRRETVTSATSSILLERPDTFGSLQFPEDPGVLH
FSEKCVMNNYFGIGLDAKISLEFNNKRDEHPKKCSSRTKNMMWYGVLGTKELLQRTYKNL
EQRVQLECDGVPISLPSLQGIAVLNIPSYAGGINFWGGTKEDNNFGAPSFDDKKLEVVAV
FGSIQMAVSRVINLQHHRIAQCRVVKITIRGDEGVPVQVDGEAWIQPPGVIRIQHKNRAQ
MLTRDRAFESTLKSWEDKQKGESYRTAARPRLSSQQSMEYLTEEESSLLQQLSRVAETLI
ARIREAAKAHKGLSRNAAVEVVLSIKALYTETRAFLEGKAVSVGLGTPPSPPAQVSPPPT
GGTGAGDGPCPPQLDSALEEEALQGPLSALGQELQRLLDIHWLGPIAHPSEEEGASSANK
GSFKLRLNIPKPRKDKAQKQKSNSALPADKWGAEEVAAWLETLGLGEYREIFIRHDIQGS
ELILLERRDLKDLGITKVGHMKRILQAIKELS
Download sequence
Identical sequences G1NBS3
ENSMGAP00000010117 ENSMGAP00000010117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]